BYKdb

Dataset for cluster tadcd of phylum rhodothermaeota

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|A0A271IYV2 [Bacteria] Bacterial tyrosine kinase [Rhodothermaeota][Rubrivirga marina] (length=785 residues).
MPTPQPFPPETFGASPPPPDYSRPGYVYGPPRRPADLASQLREWVDVVVRGRWLILACVAAVLVPVTAYVVTAPDVYEAS
SYLYVETSSGGGLSGMMPTGSDVVPFVQDQGISNELYILQKAEDLPRAVAATLLAQAASEEAPPLTVVETETGELASVEE
VADRVTEYIRVQQDGGDRTNGVRVAAKSTSPQEAALIAQLYAQAYVDRTQNSSRASVAASREFLESQADSVAAQLRSREE
AARAYMDEEGAVRLDEEASNIVSQLAALQAERDQARVEAGMEASRIAELRAQIARLEGTVAQRMGSGTARELRQDEERLA
ALRERLETIYLNDPALRSRSDVPADVAQLRRQIDQLETRVQQRSDQLVEEAIAAGGVDAAAEGLPRLSALRDRLTEAEVA
LQGLRSQISILNDRIAAYQSDLDQIPSQSVELARLIRERESAERLALGLDQRLQEARVAESAELGYAEVVRSADVPEDPV
APNRPQTLILGLILGLGLGVMLAVGRAQLDQTLRRPTQLRELGHPILGVIPDVTKLIEEDAGGADAVTVQGWTLDSRVVT
ILYPMSAGAEAFRGLRTSVQFSKPDAVVQTLLVTSASPGEGKSTVAANLAAVIAQSGRRTLLIDADLRRPRVHSLFGMSK
TPGLSEYISGQGDQRDITVGDEFDVLPAGTMVPNPAEYLGSKAFRDLLDGFRQTYDVVVIDAPPVLAATDPVLLSTQVDG
TVVVAAAGQTKDFELEHAVQEIHNVGGDVLGVVFNRFDVSKEYGYRYQYAYRYGRKYTYGHEGNA
>gnl|bykdb|A0A271J0V4 [Bacteria] Bacterial tyrosine kinase [Rhodothermaeota][Rubrivirga marina] (length=786 residues).
MPELPYPTVTDRTSPGAPYRGEEPFYYGDQDGLDLRALLDILLRGKWIILATMLALAVPVVLYSIVSPSKYRAYSILLVD
KTDTDLADVLPEQVPTAFWRQERNLSNELLVLDQSTELAESVARRLMEAGRVPGTERPLSILNDDDPATPLTVEEVAFRL
QKEYINSSMETGGADAIRVNAVSTDPAEAALIANAFSEAFADLTQDQSRSSASASREFLEDQVETQNERLREADAAVEDY
MLQEGAVALQEETTRLVDQIATLDARRDQASVNLQTKRAELAALQGELARLEGQLGDRLSSNLDGQLVTVREQIQQLRGE
LETFYSQNPALRTNPNPPANIARLRSELQRAESEQDRIARALSEQSLASSTGPNDQASGFSRAAELRSQISAARVAVRGL
EAEVRQVGARLGQYEGELSSVPEQSIELAQLERDRRAAETLYGALEQNLQQARVAEQSQLGYARVIRPAFPPTRAFSPLR
VRNTVLALLCGLVFGGLLAIGRVKLDHRIHTPDDLGKLGFPVIGTVPSTDTLVKEEYGGAEAAEVNGRMVDTHVVSLLNP
MATASESYRALRTNIQFSRPDVVVQTILVTSANPGEGKSVTSSNLAVVFAQAGRRVLLVDSDLRRPTVHKKLGIPREPGL
VQELFTDDEINPDALDRLADDLYVLPAGSIAPNPSELIGSRRMRDLIEDMRSKFDIIIFDAPPILAATDAVLLSTQCDAT
LVIARAGETKDFELQSAMTALADVGTKPSGLVLNAFDVRQAYGYRYKYAYRYGSSYGYGSSKVTEA
>gnl|bykdb|A0A271JH24 [Bacteria] Bacterial tyrosine kinase [Rhodothermaeota][Rubrivirga sp. SAORIC476] (length=789 residues).
MIDQPYPTAADRGAPGAPVRGEDPFYYGDRDGIDLRALLDILLRGKWIILGAVLALTIPVMVYSMLSPSKYRSYAILLVD
KTDTDLADVLPEAMPSGFWRQERNLSNELLVLDQSMPLAEAVAARLIEAETVPGTNRPLPILRDDDPSTPLTVQEVAFRL
QRGSIKSTMETGGADAIRVNAVSTDPQEAALISNTYAEAFAQLTQDQSRSGASASREFLEDQVETQNDRLQETDAAVEQY
MLREGAVALQEETSRLVDQIATLDARRDQAQVNLVTKRAELAALQSELSRLESQLGTRLSSNLDSELAAARERIQQLNAE
LEVFYRQNPALRNDTNPPANIARLRTELARVEADQERIARQLSAQSLASGSSPDDQRSGFVRAADLRAQISAARVAVRGL
EAEVSQVSSRLGQYESELSNVPAQSIELAQLERERQAAETLYGALEQNLQQARVAEQSQLGYARVIRPAFPTPAPFSPLR
ARNTILALLCGLVFGSLLAIGKVRLDHRIHTPDDLAKLGHAIIGTVPSTTALVKEEYGGADVAEVNGRMVDTHVVSLLNP
MATASESYRALRTNIQFSRPDVVIQTILVTSSNPSEGKSVTSSNLAVVFAQAGRRVLLVDADLRRPTVHKKLGISREPGL
VQQLFSSESIQATTLDQLADDLYVLPAGSLAPNPSELIGSRRMRDLIADMRTKFDIIIFDAPPVLAATDAVLLSTQCDAT
LVIARAGQTKDFELNSALAALKDVGTKPSGLVLNAFDVRQAYGYRYKYAYRYGNAYGYGSPKAADQPDA
© 1998-2019