BYKdb

Dataset for cluster orphancd of phylum spirochaetes

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A1W9VL88 [Bacteria] Bacterial tyrosine kinase [Spirochaetes][Spirochaetaceae bacterium 4572_7] (length=227 residues).
NITKRIYMEAFKSIRTNLQFLPGNEHNDIISITSSVSGEGKTTIAASLAETLARGEKSVIILDLDMRNPSLHEEFNVAND
IGMSNYLTMQYTLREVVKETDIYGLDIITTGSLPPNPSELILSTAFTKLLETLKRQYDYIIIDTPPIGLVTDAAIIMNYS
DISFVVVRIQYTRKEFVSNIDKMSKDYSQNRMGIILNATNLNSESGNGYGSTYAYGYGNSQYYQDRG
© 1998-2019