BYKdb

Dataset for cluster tadcd of phylum spirochaetes

[Download (right click)] [Alignment] [Repertoires]

12 sequence(s)

>gnl|bykdb|A0A1V5RSB2 [Bacteria] Bacterial tyrosine kinase [Spirochaetes][Spirochaetes bacterium ADurb.Bin315] (length=855 residues).
MNQAYDDQYTVHQQFDEEGMTIRELLSIFRKRFFWFLLGLVLVSGAAVGYLFWATPLYESQVSVLVNPIQNSSSIDSLLS
VTSSGAKIATEVELITSRSNINEALARLDLTRYENDEGESYAADIAFPNSVKEKISVTTVKDTNIVRISVTDANRFFARD
FANVLAESYDSMLTSIARNSKTAQRTFIESQIPINDQALREANDRLGDFKERSEIIQLSDKSSLLVNQISYYDLRLEPLK
LQLEEAYIGFRSHEPFIAASGTTSDQLLTTIRSDEEISKKLSELESWLLELAMYESLPTNLGQGALSEGTLARIFTINNA
IDTTKKSLLNRVRKLIECCYIDSLAQNIAQILTTGVSIDILQSRAAVFEEELSRLPLLERTLSELLRDVQISEAIGLKLR
EMLEEIKLLEASVSGNVKVIDTANLPLKPVSPNSLLILAVALLLGSAIGLLLALLVESLDTSIQNEEQVQRIVGRNAPML
GWVPIMKTYQKDVYPMFMVRTHPNSFEAERLKLIANMIYSMDGKKVFSITSSSMAEGKSMIVANISLALAQLGNKVLVVD
GDLRLPSMERFFRLEHQSVGLVDAVTSGVSLEDCIVQPLEDVSTLHLLPAGSSPLVPAAIFSNPRYISWTKMLSNIYDYI
IIDAPPLDAASELLAIAKHVDGLIITVRAGVTSRIALRDLLESLINANVQLAGFVFNGVMPSKHSRYGTYGYSVSYKMGK
TERKFGRKYRYLPRRRTASWYRKRYKQDVKIRGKLPALFTPVRAFGPHAPYMNLKEMEEKNNGNGEEKLIFKPVASGDAG
SRSKEVAEKRDETGAEKSVFTPAAFKDTPKHPMTEDKVIDFLSAIEGDEAARGKK
>gnl|bykdb|A0A2N1RHF1 [Bacteria] Bacterial tyrosine kinase [Spirochaetes][Spirochaetae bacterium HGW-Spirochaetae-8] (length=836 residues).
MDSMNMAQQIPDDDMQEGMSIKELLHILKVRLAWIIVVFVLVVAAAVGYLQYVTPMYESEVTILVDSLQKGTDFESMLLG
QSTAKISTEVELTLSRSNIESALAKLDLSRYRTEDGVSYAGEGIVGNIKGRTSVTTVKDTNIVRITVTDQDPTFARDFAN
ALAESYNELLGSIARNNKTIQKDFIQSQIPINEKQLQAAADALGRFREESNYIQLSDKSKLLSEKIAYFQLRREPLALQL
KEADLIIQAHEETLSSFALETPGYDEVLADIDMGNLLESYMQRSRELIMYEAIQEGVPEGSDRLFVLQSALNQLSKSLLD
RVTLLVAPRGLSTDPFIMVTSQELAKAMHQRAMTEAQMSVLESIEMTYSDELSHLPILERQLLDLQRDVEVYETLRMRLM
ELLEEVKIAEAAVAGSVTVVDPAIVTQNREGTAIPVSPNKMLILAVSVLLGGALGILLALLVEMLDVTIKDEGTLRKLAG
PNRPLLGWIPLMSFNQDLDIPSLVVHNDPLSFESERYKLIANNVSFGTMRNNQRIFSITSPGMGEGKTSATANIATSMAM
NGLKVLVIDGDLRLPQLETFFNLKKSPQGLVDVVTTEISVEEVIIQPLGDIPSLHLLPPGLLPPLPSAIFNSTEYVEMLD
HLLGLYDYVLIDTPPLVFASELMAIAKHVDGIALNVRAGVSTKGGLRELLDNLDLAGINVLGVIFNGVIESKMGGHYSSG
RYYTYQGSSYAKRYYSSRYNTGDKEGKKASQSTKVRSSYRQNFLKDLKRREKSRNLGTATPIHPFIDKRDPFLDDDHSSK
PISNILRKKVDDGNRAYADLLAAIEDDPRATGRIEE
>gnl|bykdb|A0A2N1RZJ4 [Bacteria] Bacterial tyrosine kinase [Spirochaetes][Spirochaetae bacterium HGW-Spirochaetae-4] (length=836 residues).
MDSMNMAQQIPDDDMQEGMSIKELLHILKVRLAWIIVVFVLVVAAAVGYLQYVTPMYESEVTILVDSLQKGTDFESMLLG
QSTAKISTEVELTLSRSNIESALAKLDLSRYRTEDGVSYAGEGIVGNIKGRTSVTTVKDTNIVRITVTDQDPTFARDFAN
ALAESYNELLGSIARNNKTIQKDFIQSQIPINEKQLQAAADALGRFREESNYIQLSDKSKLLSEKIAYFQLRREPLALQL
KEADLIIQAHEETLSSFALETPGYDEVLADIDMGNLLESYMQRSRELIMYEAIQEGVPEGSDRLFVLQSALNQLSKSLLD
RVTLLVAPRGLSTDPFIMVTSQELAKAMHQRAMTEAQMSVLESIEMTYSDELSHLPILERQLLDLQRDVEVYETLRMRLM
ELLEEVKIAEAAVAGSVTVVDPAIVTQNREGTAIPVSPNKMLILAVSVLLGGALGILLALLVEMLDVTIKDEGTLRKLAG
PNRPLLGWIPLMSFNQDLDIPSLVVHNDPLSFESERYKLIANNVSFGTMRNNQRIFSITSPGMGEGKTSATANIATSMAM
NGLKVLVIDGDLRLPQLETFFNLKKSPQGLVDVVTTEISVEEVIIQPLGDIPSLHLLPPGLLPPLPSAIFNSTEYVEMLD
HLLGLYDYVLIDTPPLVFASELMAIAKHVDGIALNVRAGVSTKGGLRELLDNLDLAGINVLGVIFNGVIESKMGGHYSSG
RYYTYQGSSYAKRYYSSRYNTGDKEGKKASQSTKVRSSYRQNFLKDLKRREKSRNLGTATPIHPFIDKRDPFLDDDHSSK
PISNILRKKVDDGNRAYADLLAAIEDDPRATGRIEE
>gnl|bykdb|A0A2N1SPK0 [Bacteria] Bacterial tyrosine kinase [Spirochaetes][Spirochaetae bacterium HGW-Spirochaetae-2] (length=836 residues).
MDSMNMAQQIPDDEMQEGMSIKELLHILKVRLAWIIVVFVLVVAAAVGYLQYVTPMYESEVTILVDSLQKGTDFESMLLG
QSTAKISTEVELTLSRSNIESALAKLDLSRYRTEDGVSYAVEGIVGNIKGRTSVTTVKDTNIVRITVTDQDPTFARDFAN
ALAESYNELLGSIARNNKTIQKEFIQSQIPINEQQLQAAADALGRFREESNYIQLSDKSKLLSEKIAYFQLRREPLALQL
READLIIQAHEGTLSSFALETPGYDEVLADIDMDHLLESYMQRSRELIMYEAIQEGIPEGSERLFVLQSALNQLSKSLLD
RVTLLVAPRGLSTDPFIMVTSQELAKAMHQRAMTEAKMSVLESIEMTYSDELSHLPILERQLLDLQRDVQVYETLRMRLM
ELLEEVKIAEAAVAGSVTVVDPAIVTANREGTAIPVSPNKMLILAVSVLLGGALGILLALLMEMLDVTIKDEGTLRKLAG
PNRPLLGWIPLMSFNQDLDIPSLVVHNDPLSFESERYKLIANNVSFGTMRNNQRIFSITSPGMGEGKTSATANIATSMAM
NGLKVLLIDGDLRLPQLETFFNLKKSPQGLVDVATTDISVEEVIIQPLGDIPSLHLLPPGLLPPLPSAIFNSTEYVEMLD
HLLGLYDYVLIDTPPLVFASELMAIAKHVDGIALNVRAGISTKGGLRELLDNLDLAGINVLGVIFNGVIESKMGGHYSSG
RYYTYQGSSYARRYYSSRYNTGDKEGKKASQSTKVRNSYRQNFLKDLKRREKSRNLGTATPIHPFIEKRDPFQDDDHSSK
PISNILRKKIEDGNRDYEDPLAAIEDDPRATGRIEE
>gnl|bykdb|A0A356E0K2 [Bacteria] Bacterial tyrosine kinase [Spirochaetes][Sphaerochaeta sp] (length=849 residues).
MSQQEEMQNTLAPYDSGEEGISIAELLHIFRKRFRWFVIGLVLVVGLAVGYLQIAIPQFESQVSVLVEPIQRSSSFESLL
NVSASTTKIATEVELITSRKNIEYALGTLDLASYRNADGMDYRSKDVLGDVKERIVVSTVKDTNIVRITVTDANPAFARD
FANALATSYDSLLTGIAKNSKTAQREFIESQIPINDRELSRASDALGDFRENSDIIQLTDKSSLLVEQISYYTLRLEPLK
LQLRESEVFIDTYNASLKQAGVEGVLTLDQIKKDSVVMAKLSDLSAWKTELTMYESLSNLAGNASTAAPSTTLDSSSRIY
VINSAINQVTKELLNRVADLTRSYANEANTQAIVQALTTEVGIQVLQQRGAVFVEELSQLPVLERRLSELQRDVQIYEAI
GLKLREMLEEVKLTEAAVTGNVTVIDAANLPLNPVSPNKLLILAVALLLGAAIGLLLTLGIEALDVSLQSEQQIQKIVGN
DVPILGWIPMMKVSEKDKYPTLSVYNDPLSFESERFKLIANMLYNKTDKKVFSITSCAMAEGKSTIIGNIALALAQMGSK
VLIIDGDLRLPSMERYFRLKHREVGLVDFVTKKTKLEECLIQPFENTPTLHLLPPGNAPLVPAAIFSNPRYIQGLQYLEK
LYDFIIIDAPPLDSASELLSISKHVDGLIITVRAGISSKGSLYDLVSNLRTANAPLIGFVFNGVIPGATSSYGYGYGRNY
GYGYSAYRYGYAQGQGTAKKKKANIRRRSTSWYRKRYKLDLKDRGKINSEQFEPVLAFGEHAEYRTLEAWAGEHATTHST
VFPEARTSGFTDSPAAKVEEKPVVQPVQDAVKHDGLGVIERDPDAVGKK
>gnl|bykdb|A0A372MIZ7 [Bacteria] Bacterial tyrosine kinase [Spirochaetes][Sphaerochaeta halotolerans] (length=852 residues).
MSQQEEYAQSTSPFDAGEEGISIAELLHIFHKRLRWFFVGFILVVALALGYLQIAIPQYESEVSVLVDPIQTSSSFESLM
DMSASSTKIATEVELITSRSNIDYALSTLDLSQYKNADGFDYRDKLVLGNLKERIAVTTVKDTNIVRIKITDENPVFARD
FANALASSYDTLLTGIAKNSKTAQREFIESQIPINDRALSAAGDALGDFRENSDIIQLTDKSSMLVEQISYYTQRLEPLK
LQLREAMVFLDSYNEGLTQAGVTGVLSLDDVRRDPVIAEKLNDLAAWKTELTMYESLGNSSAPQTQVSMPMDASSRTYVI
SSAMNQLNKDLLDRVSLLTRSYGNESYTQAIVQALTTEVGIQVLEERGEVFISELSQLPVLERRLSELQRDVQIYEAIGL
KLREMLEEVKLVEASVSGNVTVVDEAILPRNPVSPNRVLILAVALLLGAAFGLLLTLAIEALDVSIQTEQQIQKIVGKDV
PLLGWIPMMKVSNLDLYPTLIVYNDPLSFESERFKLVANMLYNRSEKHVFSITSCSMAEGKSTIIGNIAVALAQMGSKVL
IIDGDLRLPSMERYFHLKHREVGLVDYVTKNATLEACILKPIEKVPGLHLLPPGNAPLVHAGIFSNPRYTRLISYLESVY
DFVIIDAPPLDSASELLSISKHVDGLIITVRAGITSKGSLFDLISSLRTANVPISGVVFNGVVPGSVGTGYRYGYGYGYG
KGYGYSSYASRYSAMGSSGTLKKRRKHQVRKRSNGWYRKMYKRDVKNRGKLSQEQFDAVLAFGPDSPYATIADWVEAERE
NGKTKPNETRQTEVPSAKQEDPRPSSDPVEQDLASLRDIENDADAAGKKRED
>gnl|bykdb|A0A375AMC2 [Bacteria] Bacterial tyrosine kinase [Spirochaetes][Sphaerochaeta dissipatitropha] (length=856 residues).
MSQQEELQNTLAPYDSGEEGISIAELLHIFRKRFRWFVIGLVLVVGLAVGYLQIAVPQYESQVSVLVEPIQRSSSFESLL
DVSASTTKIATEVELITSRKNIEYALGTLDLSSYHSSDGIDYRSKEVLGNVKERIVVSTVKDTNIVRIAVTDANPAFARD
FANALAASYDSLLTGIAKNSKTAQREFIESQIPINDRELSKAGDALGDFRENSDIIQLTDKSSLLVEQISYYTLRLEPLK
LQLKESEVFIDSYNASLKQAGIDGVLTLEQIKNDSVIISKLADLSAWKTELTMYESLSNPARNTATLAPSTTLDSSSRTY
VISSAISQVTKELLNRVASLTKKYANEANTQAIVQALTTEVGIQVLQKRGAVFVEELSQLPVLERRLSELQRDVQIYEAI
GLKLREMLEEVKLTEAAVTGNVTVVDAANLPLNPVSPNKLLIIAVAMLLGAAIGLLLTLGIETLDVSIQSEQQIQKIVGK
DVPILGWIPMMKVSDNDKYPTLSVYNDPLSFESERFKLVANMLYNKTDKKVFSITSCAMAEGKSTIIGNVALALAQMGSK
VLVIDGDLRLPSMERYFRLKHREIGLVDFVTKKTRLEDCLIQPFENTPTLHLLPPGNAPLVPAAIFSNPRYIQGLSYLEN
LYDFIIIDAPPLESASELLSISKHVDGLIITVRAGITSKGSLYDLVSNLRTANAPLIGFVFNGVIPGTTSSYGYGYGRGY
GYSAYRYGYAQGQSGSRKKSKSHSRRRSTSWYRKRYKQDLRNRGKISSEQFDPILAFGEHAEYRTLEAWAQEHATTHSTA
FTEARTSVFADLPPSKVESKPASPQQKPKADLPVVELDGLGAIEKDPDAVGKKQEE
>gnl|bykdb|A0A3C1LV35 [Bacteria] Bacterial tyrosine kinase [Spirochaetes][Sphaerochaeta sp] (length=822 residues).
MDRKEEAKVRSVNYAEKQAEQEISITQILGIIKQRRVWVYVFFVLACALAVFYLKITDPSYQASATALVEPISNATSIES
LLTSSTSSTKIDTEIQLITSSSNLQNALDKLDLTKYLDPDGIPYSEKKLKGSSFSKVVSVSTVSSTKVVKITVEDGNPQF
CADYANAILEAYTEMLTRISKNSKSAQREFLETQIPETEALLDEASEKLADFKETSGIMQMTQKNTLLTSKIAAFQLEKA
PLSLQLVEVESLLASLNSDGSLMAVETIAQNDAVRVSLEEYVSNSKELMMYQNVDATASSSRVYVLESSLASNEKNVLNA
VTEIVGSENTMYAKAITEYLCVKASISAIDNIIESYNEELSDYPIMERQYLELQRDVEIYEQLLLSLRQLLEETKMVEAA
VVGNVNVIDEAVVPIRPVSPKKLMVMAIAVVGGVVLGVLFGLFLEFIDDSIRSEDSIKQILGSEIPSLGWTPYVKNVEKI
QKEIPALYVFNDPDAAVSERFKSIANNIVYSLPKKIQVLSINSTEMGEGKTTAICNVATAYALSGKKVLLIDGDFRKPAI
EAFFCLKRSKLGFVDAIVDDVPLEKCIVRPLAQVPNLHLMPPGKGTRNPNALYNSPKADAVLAKLKAVYDYIIIDCPPIS
YGSEFTHLARHLDGFVINVRAGVSSKRALSSFMSELDFINAPLLGYIYYGVIARNQSSYSNYGYGSYYGNKKYGYGYGYG
YGNKKSMYEEGKGNYKIIYKKEIQHRSEVRHGNREPVLAFAGGAENAFTGSQSAKAGNVSQVLKPEAKPAQKSSAKPSGT
KMSAAEKKTSDMLADIEKIYRK
>gnl|bykdb|A0A3C1ZMS7 [Bacteria] Bacterial tyrosine kinase [Spirochaetes][Sphaerochaeta sp] (length=803 residues).
MSQQEEMQNTLAPYDSGEEGISIAELLHIFRKRFRWFVIGLVLVVGLAVGYLQIAIPQFESQVSVLVEPIQRSSSFESLL
NVSASTTKIATEVELITSRKNIEYALGTLDLASYRNADGMDYRSKDVLGDVKERIVVSTVKDTNIVRITVTDANPAFARD
FANALATSYDSLLTGIAKNSKTAQREFIESQIPINDRELSRASDALGDFRENSDIIQLTDKSSLLVEQISYYTLRLEPLK
LQLRESEVFIDTYNASLKQAGVEGVLTLDQIKKDSVVMAKLSDLSAWKTELTMYESLSNLAGNASTAAPSTTLDSSSRIY
VINSAINQVTKELLNRVADLTRSYANEANTQAIVQALTTEVGIQVLQQRGAVFVEELSQLPVLERRLSELQRDVQIYEAI
GLKLREMLEEVKLTEAAVTGNVTVIDAANLPLNPVSPNKLLILAVALLLGAAIGLLLTLGIEALDVSLQSEQQIQKIVGN
DVPILGWIPMMKVSEKDKYPTLSVYNDPLSFESERFKLIANMLYNKTDKKVFSITSCAMAEGKSTIIGNIALALAQMGSK
VLIIDGDLRLPSMERYFRLKHREVGLVDFVTKKTKLEECLIQPFENTPTLHLLPPGNAPLVPAAIFSNPRYIQGLQYLEK
LYDFIIIDAPPLDSASELLSISKHVDGLIITVRAGISSKGSLYDLVSNLRTANAPLIGFVFNGVIPGATSSYGYGYGRNY
GYGYSAYRYGYAQGQGTAKKKKANIRRRSTSWYRKRYKLDLKDRGKINSEQFEPVLAFGEHAEYRTLEAWAGEHATTHST
VFP
>gnl|bykdb|A0A3D1WX44 [Bacteria] Bacterial tyrosine kinase [Spirochaetes][Sphaerochaeta sp] (length=836 residues).
MDSMNMAQQIPDDDMQEGMSIKELLHILKVRLAWIIVVFVLVVAAAVGYLQYVTPMYESEVTILVDSLQKGTDFESMLLG
QSTAKISTEVELTLSRSNIESALAKLDLSRYRTEDGVSYAGEGIVGNIKGRTSVTTVKDTNIVRITVTDQDPTFARDFAN
ALAESYNELLGSIARNNKTIQKDFIQSQIPINEKQLQAAADALGRFREESNYIQLSDKSKLLSEKIAYFQLRREPLALQL
KEADLIIQAHEETLSSFALETPGYDEVLADIDMGNLLESYMQRSRELIMYEAIQEGVPEGSDRLFVLQSALNQLSKSLLD
RVTLLVAPRGLSTDPFIMVTSQELAKAMHQRAMTEAQMSVLESIEMTYSDELSHLPILERQLLDLQRDVEVYETLRMRLM
ELLEEVKIAEAAVAGSVTVVDPAIVTQNREGTAIPVSPNKMLILAVSVLLGGALGILLALLVEMLDVTIKDEGTLRKLAG
PNRPLLGWIPLMSFNQDLDIPSLVVHNDPLSFESERYKLIANNVSFGTMRNNQRIFSITSPGMGEGKTSATANIATSMAM
NGLKVLVIDGDLRLPQLETFFNLKKSPQGLVDVVTTEISVEEVIIQPLGDIPSLHLLPPGLLPPLPSAIFNSTEYVEMLD
HLLGLYDYVLIDTPPLVFASELMAIAKHVDGIALNVRAGVSTKGGLRELLDNLDLAGINVLGVIFNGVIESKMGGHYSSG
RYYTYQGSSYAKRYYSSRYNTGDKEGKKASQSTKVRSSYRQNFLKDLKRREKSRNLGTATPIHPFIDKRDPFLDDDHSSK
PISNILRKKVDDGNRAYADLLAAIEDDPRATGRIEE
>gnl|bykdb|F0RTV6 [Bacteria] Bacterial tyrosine kinase [Spirochaetes][Sphaerochaeta globosa] (length=870 residues).
MSQQEELQNTLSPYDSGEEGISIAELLHIFRKRFRWFVIGLIVVMGLAVGYLQIAVPQYESQVSVLVEPIQRSSSFESLL
DVSTSTTKIATEVELITSRKNIEYALSTLDLASYHNADGVDYRSKEALGNVKERIVVSTVKDTNIVRIAVTDASPAFARD
FSNALAASYDSLLTGIAKNSKTAQREFIESQIPINDAELSNASDSLGDFRENSDIIQLTDKSSLLVEQISYYTLRLEPLK
LQLKESQVFIESYTNSLKAAGIAGVLALDQIKNDSVVMAKLADLGAWKTELTMYESLSNPAGNTATVAPSTVLDSSSRTY
VISSAISQVTKELLNRISTLTRSYGNEAYTQAIVQALTTEVGIQVLEMRGEVFVEELSQLPVLERKLSELQRDVQIYEAI
GLKLREMLEEVKLTEAAVTGNVTVVDAANLPLNPVSPNKLLILAVAMLLGAAIGLLLTLGVETLDVSIQSEQQIQKIVGK
EIPILGWIPMMKVSENDKYPTLSVYNDPLSFESERFKLVANMLYNKTDKKVFSITSCAMAEGKSTIIGNMALALAQMGSK
VLVIDGDLRLPSMERYFRLKHREVGLVDFVTKKARLEDCLIQPFENTPTLHLLPPGNAPLVPAAIFSNPRYIQGIAYLEN
LYDFIIIDAPPLESASELLSISKHVDGLIITVRAGITSKGSLFDLVSNLKTANAPLIGFVFNGVLPGSSSSYRYGYGKGY
GYGYGHYAYRYGYAQGQGNARKNSKGHMRRRSTSWYRRRYKLDLKNRGKITTEQFDPVLAFGEHAEFRTLEAWAQAHAST
HSSAFFEAKASPSVASQSAPVVQVEEKSATPAVPVAPKQSEKPAKKANVPFDSLSVIEMDELAIGKKQED
>gnl|bykdb|G8QXQ5 [Bacteria] Bacterial tyrosine kinase [Spirochaetes][Sphaerochaeta pleomorpha] (length=823 residues).
MNENTETQTGQNIYDNNDEGISLSELLKIFKHHFKWFLFGFFLVVGMAVVYLQLAIPQYESGVSVLVDPIQKSSSIENLL
ESSASSTKIATEVELITSRKNIEFALSTLDLDSYKNAEGDSYSNREVLGNVKDRIVVSTVKDTNIVKIVVTDASPMFARD
LANALASSYDGLLTGIAKNSKTAQREFIDAQIPINQKMLVLASDALGDFRENSDIIQLTDKSTLLVNEISYYKLRLEPLK
LQMQEASVFIQNYNQGLVNAGIKGILTLDELGNDVKIKAKLKELNGWKTELTMYESLSSPQIGTSATSLSSNNSSRVYFL
NSAIEQITKDLLDRVSVLTSAYANESNTQSIVQLLTTEVAIQVLEERGAQFTNELSQLPVLERQLSELQRDVQIYETIDL
KLRDMLEEVKLVEAAVTGNVTVVDQANIPLNPVSPNKLLILAVALLLGCAVGLLFALGIEASDQTIRNEAQIKKLVKNAI
PLLGWLPLMKVSPKDKYPMFSVFNDPLSFEAERFKLISNMLYNKHDMKVFSITSCSMAEGKSTIVANVALSLAQMGKKVL
IIDGDLRLPSMERFFLLKHSESGLVDYVINSVPLERSIVQPLDSVPNLHLLSSGSTPLVPAAIFSNPNYIETLKHLKTLY
DFIIIDAPPLDSASELLTISKNIDGLIITVRAGVTSKLSLIDLVDNLKTGNAPILGIVFNGCSAGTTNSGYHYGNYYNSY
AYRYNSYQNNNSKKGLKLSNYKIQNSSGYRKKYRQNIRQRDNQKLDLSDTVLAFGPQSYCHSLHEWGDVQHFNPVTGIGP
QHNADFKDGLEAIENDLESIGKL
© 1998-2019