BYKdb

Dataset for cluster orphancd of phylum tenericutes

[Download (right click)] [Alignment] [Repertoires]

28 sequence(s)

>gnl|bykdb|A0A061A9I9 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Acholeplasma oculi] (length=250 residues).
MRRRKLFQKERTAQYDYIVSHEQPLSFVAEAFQKALVNLEYVNIDGNLKVIQFTSSLAGAGKTTFVSNLAYLIAKKGKKV
VIVDLDLRKPKINRVFKAANENGLTDYLAGRINYDKLIGYSEKLGINYIVAGERTTAVVNVLEAQKLKDLIARLKTEFDY
VLLDSPPVIAVSDALYISRLADGVLFVVAQNEAKRAVINEALKTLRQSNVNVIGSVFTQVDLKENDIYSYTYGYGYGYTS
SDKEAFEEKE
>gnl|bykdb|A0A088TM87 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Candidatus Izimaplasma sp. HR1] (length=222 residues).
MSYKIITKEEPHSVVTEQYKKVRTAIDFSSIDKKVKVINLTSTFPSEGKTVTSINLAMVYAQTGKKVLLVDMDLRIPKIH
RFFNLPNKDGISGYVDSRDIKKCIQKGTDNLDILVTGKKTPFPSELLASKVVNEMMEKLRDMYDVIIIDCPPMTAVTDAS
IISNFSDGTVYVLASRRTNRDMANKAINDLKKNGANILGGVLTRVSKRDSNYGADYYYYYGE
>gnl|bykdb|A0A1G3VWH5 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium GWD2_38_27] (length=240 residues).
MSKKKINIFQIERNERYDYLVTKEQPLSYTSECFQKVLINIDYANLDNDMKVLQFTSTLASEGKSTFISNLAYLLGQKGK
KVILIDLDLRKPKMNRVFNVTNREGLTDYLSGKVQYETVVRHSEEIGVDFIVGGEKTTSVVNVLEAKKLKELIVRLKSEY
DYVLLDTPPVIAVSDALYVAKLADGVIFIVAQNVAKKSLVKEAIQTLKHNNVHIIGTILTQVDLKNGSYGYGYDYSYKYE
>gnl|bykdb|A0A1G3WJV7 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium GWF2_57_13] (length=233 residues).
MEFFEYKNVVIESPNSSEAEAYRKLELNISLAGLDRRMQVIQCTSATPEDGKTTTSINLAAVYAEKGKKVIILDFDLRRP
KIHRAFHQPNDRGFYDYVVDNVDYHDLIIHDESKIDIILSGKRISFPHIALESHRTAQLIEDLRKEYDFIVIDTPPVLSV
TDAVIISKIVDGVVYVAAYNKTRKDDSREGLKILHANNANVIGGVLANIDVRKTKQYGYRGYYYYGTDEKKSK
>gnl|bykdb|A0A1G3WM69 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium GWF2_38_8] (length=240 residues).
MSKKKINIFQIERNERYDYLVTKEQPLSYTSECFQKVLINIDYANLDNDMKVLQFTSTLASEGKSTFISNLAYLLGQKGK
KVILIDLDLRKPKMNRVFNVTNREGLTDYLSGKVQYETVVRHSEEIGVDFIVGGEKTTSVVNVLEAKKLKELIVRLKSEY
DYVLLDTPPVIAVSDALYVAKLADGVIFIVAQNVAKKSLVKEAIQTLKHNNVHIIGTILTQVDLKNGSYGYGYDYSYKYE
>gnl|bykdb|A0A1G3X100 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium RIFOXYB2_FULL_36_25] (length=232 residues).
MMKRKIDQLGSYVPISDKEPHSIITEQYRKLRTNIELSNFNQEIKSIALTSTMAMEGKTVTSINLATVYAQSGMKTLLID
MDLRKPKIHRGFKMINQIGLSDMITHKLDIDQAVQIVNPHLDILTSGTKLPYPAEFLMSDALKSLMKDLKTKYDRIIIDT
PPMTAVTDASIISSLVDGMIIVIASREAKTDVASRVIQDLKDNGANIIGSVMTRVQKREHKYMNYYYYNYKA
>gnl|bykdb|A0A1G3X178 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium RIFOXYB2_FULL_36_25] (length=239 residues).
MSKKKIFNSERNERYDYLVTKEQPLSYTAESFQKVIINLDYANIDGKIKVVQFTSTLASEGKSTFVSNLAFLLGQKDKKV
ILIDLDLRKPKMQRVFNVPNKNGLTDYLSGKISYEELIQHSADFDFDFIVAGEKTTAVVNVLESAKMKELIVKLREQYDY
VLLDTPPVIAVSDALYVARNADGVVFIVAQGVAKKTLVKEAIQNLKNNNVHVIGTVLTQVSLKGGEYGYGYDYSYKYED
>gnl|bykdb|A0A1W9S8F5 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium 4572_104] (length=359 residues).
YEDAKIAEVSQLGNVRILETAGVPRIPIKPKKMMNYLIGVILGLGLGVGASFLAHSMDTKLRTLDDIESFLKSPIIGTIP
LIDLPTGELDELRNMIDHATSERKERLERSFLQINGQLISHYSPKSPVAESYRSLRTNIIANKATGPMSFLVTSSSPKEG
KSTTVSNTAITLAQMNSKVVIIDIDMRRPTIHTKFGIKKENGASDYLIDDTITVDDIVKPSGISNLDIITSGFIPPNPSE
LLSSDRMDNFIAELKSKYDYVIFDTPPVIAVTDAIIMAKKVDKLFLVLRVAHTEKAVLGRAQEILANVNKKVDGFVVNGI
KVQKYYNRHKYYYYYYYYYYGEQNPTPKKKSLFSRLRKN
>gnl|bykdb|A0A1W9S8N6 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium 4572_104] (length=230 residues).
MEFYEYRNAVIEFPNSPEAESYRKLELNIRVFNLDNPIKVIQSTSATAQDGKTTTAINLAAVYAEKGKKVIILDFDLRRP
KIHRAFHKANDGGLYEFVVNDKDVHDLIIHDASGIDLLLTGHRLNYPHIVLQSKKIMEMVNKLRDEYDYIVVDTPPVLSV
TDALVVSKYVDGVIYVAAYNQTKKDAAKQGLEQLRESKANIIGGVLANIDVRKAQGLYGYYYYSNYDTEE
>gnl|bykdb|A0A2G7QFH1 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Acholeplasma laidlawii] (length=251 residues).
MRRRKLFQKERIAEYDHLVTYESPMSYTAEAFQKALVNLEYINVDGNFKVVQFTSTLAGAGKTTFISNVAHLIGKKGKKV
VIVDLDLRKPKINRIFRSPNENGVTDYLTGKIDYKTLINYSEKFSVHYIVAGERTTAVVNVLEAQKLKDLIARLRTEFDY
VLLDSPPTMAVSDALYISRLADGVLFIVAQNETKRTVINEAIQTLKQNKVNIIGIAFTQVDVKNSDLLSYTYGYGYGYNS
SLQDDLDKEKS
>gnl|bykdb|A0A2K8ZVD1 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium MO-XQ] (length=249 residues).
MAKKKNFSLERLINGERVSKYDYLVTKQDPLSFVTESFQKVIINIEYSNVDGDYKVIQFTSTLPSEGKSTFVSNLSYLMG
QKGKKVILLDLDLRKPKMNRVFGVPNKDGLTDYLAGKISLEKAINHSDEIGIDFITAGEKTSAVVNVLEAKKLKDLIAHL
RETYDYVLLDTPPVISVSDALYIASLADGIIFVVAQNKAKKALVKEAISNLKDHGTPILGMVLTQFDMKSGYGYNKDYSY
YNYSEEDDE
>gnl|bykdb|A0A2K9A647 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium MO-XQ] (length=233 residues).
MRNKKHKFDQRGSYQPITRIEPNSIISEQYRKLRTNIELSDFNKKIQIVGITSTNAMEGKTLTAINLAEVYAQSGKKTLL
IDMDLRKPKIHRGFRLINKKGLSDIFTKNYDITDVVEHVEANLDVLPSGSKLPYPAEFLSSEQLKSFVNNLKDVYERIII
DTPPMTAVTDASIISSFCDGMLLVIASRETEVHITKDVIKDLENNGANIIGSVLTRVSKRDSRYMNYYYYQYR
>gnl|bykdb|A0A2K9AQG7 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium MZ-XQ] (length=233 residues).
MMNKKQKHDQRGSYIPITRLEPQSIISEQYRKLRTNIELSEFNKKIQIVGITSTNAMEGKTLTAINLAEVYAQSGKKTLL
IDMDLRKPKIHRGFKLINKKGLSDIFTKKYDITEVVEHIDANLDVLPSGSKLPYPAEFLSSEQLKLFIDNLKGIYERIII
DTPPMTAVADASIISSFCDGILLVIASRDTEVHITKDIIKSLENNGANIIGSVLTRVSKKDSRYMNYYYYQYR
>gnl|bykdb|A0A2K9ATM9 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium MZ-XQ] (length=249 residues).
MAKKKNFSLERLINGERVSKYDYLVTKQDPLSFVTESFQKVIINIEYSNVDGDYKVIQFTSTLPSEGKSTFVSNLSYLIG
QKGKKVILLDLDLRKPKMNRVFNVPNKNGLTDYLAGKIPLDKAINHSDEIGIDFITAGEKTSAVVNVLEAKKLKDLIAQL
RETYDYVLLDTPPVISVSDALYIANLADGIIYIVAQNKAKKALVKEAISSLKDHGTPILGMVLTQFDMKSGYGYNKDYSY
YNYSEEDDE
>gnl|bykdb|A0A2N1PFF8 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium HGW-Tenericutes-8] (length=232 residues).
MKLFTKKTADNYGYLIAKEAPNSYVTESLQKLIVNLEYANIDQKYKVVQFTSSMQAEGKTTLISNVAYLLAQRGKKVLMV
DLDLRRPKINRIFSVINKSGLTEYLLGKIEKKDLIQHSEDKVDFIISGEKTTSVVQVLQSQKLQDLFTELRQEYDYILLD
TPPVIVVSDALLVNKVADGIIFVVAHGLGRKSMVKEAISSLTRNNVPIIGIAMTQDRVNKGNRYGYTYKYYD
>gnl|bykdb|A0A2N1PY17 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium HGW-Tenericutes-6] (length=237 residues).
MGKKKLNIFNGERNERYDYIVTKEQPLSYTAESFQKVLINLDYANIDHEYKVIQFTSTLASEGKSTFVSNMAYLLGQKEK
KVVLIDLDLRKPKMHRVFNVANKDGLTDFLAGKVTYQQLIKKSDDFGVDFINTGEKTTAVVNILESNKLKELIDKLKEDY
DFILLDAPPVLAVSDALYISKFSDAVIFVVAQGVAKKALVKEAIQTLKHNHVNIIGTVLTQVNIKSQGYDYTYGYGE
>gnl|bykdb|A0A2N1Q2N1 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium HGW-Tenericutes-5] (length=227 residues).
MEVFEYKNVVIETPNSPQAEAYRKLELNIRMNSIDNPYKVIQITSATPEDGKTTTAINLAAVYAEKGLKVIILDFDLRRP
KIHRAFHKINDLGFYDFIVNEKPIEELIIKDDSKIDLLLTGNMLTAPHVILQSKKVKDLIEKFRKEYDYIVIDSPPVLTV
TDALVISSLADGVVYIASYKKTKKDQAKHGLKQLKENGANVIGAVLSNVDAKKSNGYYNYYYYQREE
>gnl|bykdb|A0A2N1QAD1 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium HGW-Tenericutes-2] (length=235 residues).
MNRLNKLNKRLDSYIPISSKEPNSVISEQYRKLRTNIELSNFDKEVKVISLTSTKMMEGKTVTSINLATVYAQSEKKTLL
IDMDLRKPKIHRGFHLSHKNGLSNIITDNLELSEAIHKVTPKLDVITAGNKLPFPAEFLMSAQLKELILKLRDLYDIIII
DTPPMTAVADAAIISSFVDGTILVIASRETNIDACERVIKELKDNGANIIGSVLTRIRKKDTNYSNYYYYQYNEK
>gnl|bykdb|A0A2N1QBP1 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Tenericutes bacterium HGW-Tenericutes-2] (length=241 residues).
MSKKKNIFAPERNERYDYLVTKEQPLSFTTESFQKVLVNLDYANIDKKIKVIEFTSTLASEGKSTFVSNLAYLMGQKNQK
IILLDLDLRKPKGHRVFNSANKDGLTDYLSGKVSYEKLIKHSEEFGIDYIVTGEKTTAVINVLEAEKLKDLILKLRETYD
YVLLDAPPVLAVSDALYIAKHADGVIFVVAQNNAKKTLVREAIQTLKESNVHIIGTVLTQVSLKSGEYGYGYDYSYKYED
E
>gnl|bykdb|A0A348NKG7 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Acholeplasmatales bacterium] (length=233 residues).
MEFFEYKNVVIESPNSSEAEAYRKLELNISLAGLDRRMQVIQCTSATPEDGKTTTSINLAAVYAEKGKKVIILDFDLRRP
KIHRAFHQPNDRGFYDYVVDNVDYHDLIIHDESKIDIILSGKRISFPHIALESHRTAQLIEDLRKEYDFIVIDTPPVLSV
TDAVIISKIVDGVVYVAAYNKTRKDDSREGLKILHANNANVIGGVLANIDVRKTKQYGYRGYYYYGTDEKKSK
>gnl|bykdb|A0A350RC25 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Acholeplasmataceae bacterium] (length=239 residues).
MSKKKIFNSERNERYDYLVTKEQPLSYTAESFQKVIINLDYANIDGKIKVVQFTSTLASEGKSTFVSNLAFLLGQKDKKV
ILIDLDLRKPKMQRVFNVPNKNGLTDYLSGKISYEELIQHSADFDFDFIVAGEKTTAVVNVLESAKMKELIVKLREQYDY
VLLDTPPVIAVSDALYVARNADGVVFIVAQGVAKKTLVKEAIQNLKNNNVHVIGTVLTQVSLKGGEYGYGYDYSYKYED
>gnl|bykdb|A0A352TSP8 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Acholeplasmataceae bacterium] (length=251 residues).
MLKNKKLSVQNKLEYDYIYTKENPISFITEAHQKFLVNLEFINVDKAYKSIQITSSLSSEGKSTFLSNVAYLLGQKGLKV
ILVDLDLRKPKVHRIINKANEDGITDVLTEKISLEKAIKKDTKLGFDALVSGEKASAVVNLLQSNKMKTLFSDLKKLYDY
ILVDSPPVINVSDALYIAQITDATVFAISQQETKRSVAKEAINLLKQSNVNLIGAVATQVDIRKNAYGYGYGYGYGYGYG
YDYTYEQNGND
>gnl|bykdb|A0A353PKB4 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Acholeplasmataceae bacterium] (length=240 residues).
MSKKKINIFQIERNERYDYLVTKEQPLSYTSECFQKVLINIDYANLDNDMKVLQFTSTLASEGKSTFISNLAYLLGQKGK
KVILIDLDLRKPKMNRVFNVTNREGLTDYLSGKVQYETVVRHSEEIGVDFIVGGEKTTSVVNVLEAKKLKELIVRLKSEY
DYVLLDTPPVIAVSDALYVAKLADGVIFIVAQNVAKKSLVKEAIQTLKHNNVHIIGTILTQVDLKNGSYGYGYDYSYKYE
>gnl|bykdb|A0A357IN55 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Acholeplasmataceae bacterium] (length=232 residues).
MMKRKIDQLGSYVPISDKEPHSIITEQYRKLRTNIELSNFNQEIKSIALTSTMAMEGKTVTSINLATVYAQSGMKTLLID
MDLRKPKIHRGFKMINQIGLSDMITHKLDIDQAVQIVNPHLDILTSGTKLPYPAEFLMSDALKSLMKDLKTKYDRIIIDT
PPMTAVTDASIISSLVDGMIIVIASREAKTDVASRVIQDLKDNGANIIGSVMTRVQKREHKYMNYYYYNYKA
>gnl|bykdb|A0A3A6NBK6 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Acholeplasma sp] (length=242 residues).
MAKKNKINLFNGERNERYDYIVTKEQPLSYTAESFQKVIINLDYVNIDGKHKVIEFTSALASEGKSTFVSNIAFLLGQKN
KKIILLDLDLRKPKMHRVFNAPNKNGLTDYLSGKIEFSQLIKHSDEIGIDYIVTGEKTTAVVNVLEALKMKELIQKLRET
YDYVLLDAPPVIAVSDALYIAKNADGVIFIVAQGVAKKSLVKEAIQTLKTNHVPIIGTVLTQVSLKNNSYGYGYDYSYKY
EE
>gnl|bykdb|A0A449BLI1 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Acholeplasma hippikon] (length=271 residues).
MRRKKLFQKERVQQYDYLVVHEQPMSYHAEAFQKALVNLEYVNVDGNLKVLQFTSSLAGAGKTTTISNIAYLMAKKGKKV
VVLDLDLRKPKINRIFKAANENGITDYLAGKVKYEKLVRYDEKFKIHYIVSGEKTTAVVNVLEAQKLKDLIARLRAEFDY
VILDSPPVLAVSDSLYIARLADGVIFVVAQNEAKRAVINEAIATLKQNNVNIIGSMFTLVDVKESELYAYTYGYGYGYTS
SEQIEDTKEWLIFIHISCQTSMMGQKVMKKL
>gnl|bykdb|A9NGZ9 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Acholeplasma laidlawii] (length=251 residues).
MRRRKLFQKERIAEYDHLVTYESPMSYTAEAFQKALVNLEYINVDGNFKVVQFTSTLAGAGKTTFISNVAHLIGKKGKKV
VIVDLDLRKPKINRIFRSPNENGVTDYLTGKIDYKTLINYSEKFSVHYIVAGERTTAVVNVLEAQKLKDLIARLRTEFDY
VLLDSPPTMAVSDALYISRLADGVLFIVAQNETKRTVINEAIQTLKQNKVNIIGIAFTQVDVKNSDLLSYTYGYGYGYNS
SLQDDLDKEKS
>gnl|bykdb|U4KT93 [Bacteria] Bacterial tyrosine kinase [Tenericutes][Acholeplasma brassicae] (length=234 residues).
MVPNILKRKRKESYGYLVAREDKMSFVTESFQKLVLNLEYANVDNQYKVIQFTSTLQAEGKTTLFANIAYLLADKGKKVV
VLDLDLRRPKLNRVFSEINKDGITDYLAGKITYEQLLRVSEDGIYYMVAGEKTTAVINLLESKKLEELINKLKEDFDYVL
LDTPPVLAVADTLIINKISDGVIFVVGFGKAKKALVRDAFHALERNNAKIIGIGFTQVKMTNGVYGYKYSYKYD
© 1998-2019