BYKdb

Dataset for cluster tadcd of phylum thermotogae

[Download (right click)] [Alignment] [Repertoires]

32 sequence(s)

>gnl|bykdb|A0A0C7NW05 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Defluviitoga tunisiensis] (length=724 residues).
MDDGKLDNELTFEDILKIFKKRFWYFFITVVVTVIIALIYLFTTTPIYEASTTLKVGSSQQGSVVDIFGSQMSSGSSKIS
TEIELIKSRRNLEKVVDNLHLVDYFKERSDNPENVTKNGVIKYLGDIITVSPVKDTNIVKISVQSEDSELARSVADELAI
VYNDLLKSLSQNEYTSRRKFIEEQIPKAESELNTAQDNLRLFKEENNVFILDEEAKAILQFLVTYDQEINTYQVQLEQSK
VRIEAINDLLKNIDQEIITSETISINPVVSNLRNQIVNIQVQLAGIEGTKSANDPEVLKLKEQLFQAQEMLKKEINTIVT
SQLKSINPQYSSLYSQLIEEQANLQVIQGTIQALTSIRNTYQSELVKLPALEQKLMDYEREVKVKENLYVLLLEKLEEAK
IAEAGVIGTADIIDLAFVSPTPVKPNKTLTVVISGVLGIFLGILVVFLIEYMDKKLKDENELKSIIKGVPVLGRIPSFEI
NQESGELPVLKDPVSPISESYKMLATNISFSTTKEPNTICFSSAGPSEGKTITASNVAIFYAQNGKKTLLMDGDLRKPRV
DKIMRIKNKNLGLVNYLMRRVPLEKILFKPVESLPNFDVLPAGVLPPNPTSLLTSNEFLELLQTLKEHYEKIIIDLPPIM
VAPDAQIVSRYSDGLILVTRYNGTLKPMLKVAYENIVSSEVKLLGTVIVDIDEKTSNYYYYYYYYSDDGKKVKKRKRIDT
TLKN
>gnl|bykdb|A0A0G2ZA83 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Kosmotoga pacifica] (length=750 residues).
MDNTPDFERAEYTELTLEDIFRMFRKHRMLFVGVIIAAIALTALYLFFATPIYEASVTVKIEPTSKSSISDIFMDQVTGS
YTSKDISTEVELIKSRSNFENVIEELGLIDRMIEPEIKEKFIQEGYSEEDFIDSLAKTLSEITTVSPVKDTRIVKISVQH
ADPVLATEIANKLAEVYNEKLAELSKRDVKTKREFIDSQIPLIEADLRKATDALKTFKETYKIYVLEEHARSLLQVLSNY
DQQYNDLSLQLKEKEAEKEAYLELLQEFETSEAETRVSKWIKTSETYMNPVITQLKTKRAELEIELASLKQQYPITDPKV
QAKLSEIAKTDELIKRETENFIRTGESQTLNPAYEEALINYISSNSSIQVLESRLKAVEELKARYEAELNRLPALEQRLL
ELQRQVTVKENLYTLMLEKLEEAKISEAAVVGNAAVVDYAKPPKVPVKPNKKLSLAIGSVLGIFLGMLTVFLVEYLDKTL
KSEEEIERYSGLSVIGRVPEIENLSESEDELYVRIHPTAPQSEAIKLAASNISFLMGDEKKAIAITSVSPGEGKSFVAAN
VAFYMASSGYRTVLVDLDMRRPRVEKILGLNKKNKKNDRGITDLIKGDIKLEEAVIKDYDTNLDVIPMGSRATNPTLLLS
SKKLDELLKVLKERYDRIIIDTPPALVTSDVSLIANKLDGIVLVVRPGVALRDGLRITINNLQTVGASLLGVLVNGVNQQ
TSGYYHYYYYYYYSEGGKKRKRKTKVDDKI
>gnl|bykdb|A0A0H2SAF7 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Marinitoga sp. 1197] (length=724 residues).
MDPEIYEDELTLEDIIHIFKKRFWWFFATVVITVALTILYLFLTTPIYEASVTLKIESQQSSSISDIFSSQLTSSRPEIS
TEVELIKSRTNIEKVIDDLNLVEYFKNKTDDEKTKKEINKYNIIKTLSEMITVSPVKDTNIVKISVQSDDPEMAKKIANK
LAEVYNEFLKTLSKNEYTVKREFIEKQIPKVENDLKAAEEKIRKFKEENKVFLLDEEAKNILSFTLEYDKQINSYNLQLE
ETKAKVRAFNDLLKKVDEKIISSETISTNPFINQLKSKLINYKVELAGLTNIYSETDPKVKEIKDKIAETEKLLKEQVTK
IVTSQVKTINPAYQDIYLQLIESQYTTEVIKSTIQALTKLKETYNQKFAKLPLLEQQLLELQRDIKVKENLYTLLLEKLE
ETRIAEAGVIGTAKLIDSAITPDKPIKPNKKLTAAIGGVLGIFLGILVAFIIEYADKSIKDEEEIKRMAKGKTILGRIPT
FEMKKEYSNPELIVLNEPISPVAESIKLTSANINYSVTPEPKVIAVTSAGPGEGKTITSANLAISYAQNGLKTLLIDIDM
RKPRVEKALGLERFNIGLVNHILKNVPIERITQNYMENLDVIPVGPLPPNPTALLTSKQFGELINTLKEKYDKIIVDLPP
ILAAADALIVSKHTDGLILVVRAGKTQKHSLKIALENVITSDNTLLGLIIDDINEKNSGYYYYYYYYYEDGQKKKRKKNK
KNKN
>gnl|bykdb|A0A0H2SBE1 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Marinitoga sp. 1155] (length=723 residues).
MDPEIYEDELTLEDIIHIFKKRFWWFFATVVITVALTILYLLLTTPIYEASVTLKIEPQSQGSVADIFTSQLTSSRPEIS
TEVELIKSRTNIEKVINNLNLTEYFKNKSKDSEKEITRLDIIKTVSEMISVSPVKDTNIVKISVQSDDPELAKNIANELA
NVYNEFLKTLSKNEYTVKREFIEKQIPKVENDLKAAEEKIRKFKEENKVFLLDEEAKNILSFTLEYDKQINSYNLQLEEN
NAKIKAFNDLLKKVDEKIISSETISTNPFINQLKSKLINYKVELAGLTNIYSETDPKVKEIKDKIAETEKLLKEQVTKIV
TSQVKTINPAYQDIYLQLIEAQYTTEILKSTIQALTKLKETYNQKFARLPLLEQQLLELERDIKVKENLYTLLLEKLEET
RIAEAGVIGTAKLIDSAITPDKPIKPNKKLTAAIGLVLGIFLGILVAFIIEYADKSIKDEEEIKRMAKGKIVLGRIPTFE
KKKEYENPELIVLNSPTSPVSESVKLTATNIIYSVTPEPKVIAVTSSGPGEGKTVSSANLAISYAQNGLKTLLIDIDMRK
PRVEKALGLERFNIGLVNHILKNVPIERITQNYMENLDVIPVGPLPPNPTALLTSKQFGELINTLKEKYDKIVIDLPPIL
AAADALIVSKHSDGLILVVRAGKTQKHSLKVALENITTSDNNLLGLIINDINEKSSNYYYYYYYYYYQDGQKTKRKKNKK
NKY
>gnl|bykdb|A0A101ID04 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Thermotogales bacterium 46_20] (length=737 residues).
MNQTNGDDYRELTLEDILRIFRKRLLLFFLVVVGVVVATGIYLFLATPIYEASVTIKVDPATRSSIDIFTAGLTGTTSSR
DIATEIELIKSRSNFETVIERLELVERIYTSFEIQEMLSEGYTQNDIEASLAKTLSNITSVSPVKDTRIVRVSVQHRDRT
IARDVANTLAEVYNEKLAELSRRDATTRREFIESQIPSVEEQVRRSSDALREFKEKTGIYVLDAQARWLLDMLSNYDKQF
NALVIELEEKKAEVVAYQKLLDEFDSPEAGALQEKWINTSHTLSLNPVITQLRNKLALLKVDLAALEDQYPATDQRIRAK
KAEIAATEKLIQEEIENEFIRTGEGMSLNPTYQTILTAVITSETSLQIIESTIQSVDMLRKTYLDALAEIPRLEQQLLEL
QREVYISENLYTLLLERLEEAKISEAAVIGNAAVIDSALIPSAPVKPNRRLSLAIGGVLGIFLGMLGVFLAEYLDKTLKS
EEDIERVASEPILGRIPLANGIRNELFVQSDPTSPPSEAVKIASSNISFTLGDGKVIGVTSPLPGEGKTTVAANIAYSYA
MSGQRVLLVDLDMRKPRIEQLLGMDDRSSEGIVDIVLDNRNVGDLIIKYAENLDVLPVGKIPPNPTVLLSSKKIAALIEG
LKNEYDRIIVDLPPAVITSDVALVGHLFDGVLMVTQPGTTLRDALRMAISNLKTSGAKVLGFVVNGVTVKTSGYYYHYYY
YHYSEGTKKRKEHRKVR
>gnl|bykdb|A0A182C824 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Kosmotoga arenicorallina S304] (length=748 residues).
MDNPTDFERSEYTELTLEDIFRMFRKHRLLFVGVIIAAVALTGLYLFFATPIFEASVTVKVEPTSKSSMSDIFMDQVTGS
YSSKDISTEVELIKSRSNFEKVIADLGLVDRMIEPEVKSKMLQEGYTEEDIIDSLAKTLSDIVTVSPVKDTRIVKISVQH
ANPELATDIANKLAEVYNEKLADLSKRDVRTKREFIESQIPIIEADLRKATDALKEFKETYKIYVLEEHARSLLQILSKY
DQQYNDLSLQLNEKQAEKDAYLQLLKEFESSEAEARVSKWIKTSESFTNPVIAQLKSKRADLEIELAALKQQYPTTDPKV
QAKLTEIAKTDELIKKETENFIRTGESQTLNPAYEEALINYIGSTSSIQVLESRLQAVEKIKQGYEKQLAQLPELEQRLL
ELQRQVTVKENLYTLMLEKLEEAKISEAAVVGNAAVVDYAKPPRIPVKPNKKLSLAIGGVLGIFLGMLTVFLVEYTDKTL
KSEEEIERYSGLNVIGRIPEIEDLTENEDELYVRSHPTAPQSEAIKLAASNISFLIGDEKKAIAMTSVSPSEGKSFVAAN
TAFYLASSGYKTILIDLDLRRPRVEKILKLDSKKTDGKGITDLIKGEVDLNQVIVKNYDENLDVIPVGSRATNPTLLLSS
KTLEAILDQLKERYDRIVVDTPPALVTSDVSLIASKLDGIVLVVKPGIALKDGLRITINNLRTVGAPLLGVLVNGVNQHT
SGYYHYYYYYYGEKGKKKKRGHKEEQQV
>gnl|bykdb|A0A1E3G3X8 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Fervidobacterium thailandense] (length=739 residues).
MDGEIVREELTFEDILRIFKKRFWWFLGTLVLTIAITVIYLMVATPIYEASVTLKIEPQTKSSLTDLFVSQYTYTRPEIS
TEVELIKSRSNLEKVIENLNLVEYYKTKFPGSNMDIYSLAKMLSNMITVSPVKDTSIVRIAVQNPDPELAKNIANELAKV
YNELLQKFSKSEYTVRREFIEEQIPKLESELKQLEDELRKFKEKHGIYVLNVEVQNLLNTVYNFDNQINQYKIQLEETRA
KIVALNEQLKRTNQKIVSSETISINPVVSQLRSKLAELQVELAALLNNYSENDQRVRDTRKKIEETEKMLRNEVEKIVTA
QVQTLNPDYQNIYSQLIEAHAKYEMINSTIAAVERMREKYTAKVAQLPAVEQQLLQLERDRKVKESLYSLLLEKLEETRI
SEAGVIGRATIVDPAITPTVPVKPNKRLLLAVASVLGFFLGIMVIFMVESLDKTITDEEYIKHLLKDKPILGRIPEIQFP
AGSEHPELVVLNSPTSPGAESLKLVSTNIEYSDTVPPKAVGITSAGPGEGKTFLAANIAISYAQNGLRTLVLDLDMRKPR
VEKVFGIERAHAGIVNHILKNAPIEDITIKYMENLDIIPVGPIPPNPTALLTSKKMEEILQIFKERYDRIVVDLPPVLAA
ADAVIVSKYIDCLVLTVRAGKTQKPSLRVAYENIVTSASKLLGAVINGIGEKHMGYYYYYYYYYTQDGKRKKKVSRRRKQ
INQTKKVLGGLINDLLKRK
>gnl|bykdb|A0A1M4Y2U3 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Marinitoga hydrogenitolerans DSM 16785] (length=727 residues).
MEPEIYEEELTLEDIIHIFKKRFWWFFATVVVTIVLTLVYLFTTTPIYEASVTLKIESQQSSSISDIFSSQLTSSRPEIS
TEVELIKSRTNIEKVIDDLNLVEYFRNKTDDEKTKKEINKYNIIKTLSEMITVSPVKDTNIVKISVQSDDPEMAKNIANK
LAEVYNEFLKTLSKNEYTVKREFIEEQIPKVENELKAAEERIRKFKEDNKVFLLDEEAKNILSFTLEYDRQINQYNLQLQ
ETKAKIKAFNDLLKKVDEKIISSETISTNPFINQLKSKLIDYKVELAGLTNIYPETDPKVKEIKDKIVETEKLLKNEVSK
IVSSQVQTINPAYQDIYLQLIEAQYTTEVLKATIESLIKLKETYNKKFAKLPLLEQQLLELQRDVKVKENLYTLLLEKLE
ETRIAEAGVIGTAKLIDSAITPDKPIKPNKKLTAAIGGVLGIFLGILIAFIMEYADKSIKDEDEIKRMAKGKIILGRIPT
FEMKSKYMNSELVVLNEPISPVAESIKLTSANINYSVTPEPKTIAITSAGPGEGKTVSAANLAISYAQNGLKTLLIDIDM
RKPRIEKVLGLERFNIGIVNHILKDVPIERITQNYMENLDVIPVGPLPPNPTALLTSKKFGEVMDKLKEKYDKIIIDLPP
ILAAADALIVAKHTDGLILVVRAGKTQKHSLKIALENIITSDNKLLGLVIDDINEKNSGYYYYYYYYYYEDGQKKKRKKE
KKNGIIK
>gnl|bykdb|A0A1M5RQU7 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Thermosipho atlanticus DSM 15807] (length=721 residues).
MDPEIIQDELTLEDIIHIFKKRFWVFMTTLILTVVAVVVYLIYATPIYEASATLKIEPQSAGSITDLFTSQVTPGRPDIS
TEVELIKSRRNIETVVDDLDLVSYFRNKTQNPEITKNDVIGIVSNMISISPVKDTKIVKISVQSDDPMLASNIANRLAEV
YNELLKSLSKNEYTVKRHFIEQQIPIVEEELKKAEDNLRKFKEENNVFVLDEEAKNLLSLMLNYDSQVNSYMLQLQENKA
TIAALNEMLKKVDEKIISSETITTNPIVSQLKSKLVEYRIELAGLTQTYSESDPKVLEIKEKISETEKLLKEEVAKIVTS
QVQTINPAYQELYTQLIEAQYKGEVYDSIIKSLNKLRDTYQEKLSKLPLLEQKLLELNRDIKVKENLYTLLLEKLEETRI
AEAGVVGTASIIDKAIVPDKPVKPNKKLTLAIGGVLGIFLGILFVFLVEYADKSIKDEEELKRIAKGKVILGRIPRFELK
KDLKNPELIVLNSPTSPQAESLKLVSTNINYSVTPEPKVIAISSSGPGEGKTITAANLAISYAQNGVNTLLLDLDMRKPR
VEKVLGLKRFNMGVVNHILKDVPIEKITQNYMENLDIIPVGPLPPNPTVVLTSKKFKELINTLKEKYERIVIDLPPILAA
ADALIVSKHTDGMVLVVRAGTTQKHSLRIAIENIETSGANLLGIIINDINEKSSNYYYYYYYYYYDEEGGKKKRRFKRHK
K
>gnl|bykdb|A0A1M7RT68 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Fervidobacterium gondwanense DSM 13020] (length=723 residues).
MMDQEMTRDEITLEDLLRIFKRRFWWFFATVIAVFAVTIVYLMLATPIYEASVTINIEPKSKGSLTDLFSATGYTSSRPD
ISTEVELIKSRTNIETVVKNLNLVEYFKNKSKNSEIDTYDVIKSLSNMITVSPVKDTSIVKISVQNPDPELAKNIANELA
SVYNELLQRLSRNEYTARREFIEQQIPKVEEELKQVEDQLKKFKQTNKVYVLNVESQNLLNTLYNLDTQINTYKIKVEEV
KAKISALTQQLKSMNQKIVSSETISVNPVVSQLKAKLVDLQIQLSALLNTYSENDQQVKSLRKQIEETEKMLKNQVESIV
TSQVQTTDPNYASMYSELIQSNTELLVYQSTISSIESIKSKYEQKISTLPMLEQQLFELERDRKVKENLYSILLEKLEET
RISEAGVVGRATLVDSAITPTQPVKPNKKLTLAIGGVLGIFLGILLVFLLEAFDKTISDEEYIKHMLKGSPVLGRIPNIE
FPETSESPELVVVNSPTSPQAEALKLTATNIEYSNTPAPKIVAVTSSGPGEGKTLIAANIALAYAQNGNRTLLLDLDMRK
PRIEKVLGIERINIGVTNHLLKDIPVERIIVNYGENIDIIPVGPIPPNPTALLTSKKMEDFIQKLSEKYERIVIDLPPIL
AAADSLIVSKYTDGIVLVVRAGKTQKPSLRVAYENIQTSSAKLLGAVINDITANQMGYYYYYYYYYYTTEGKKKKKRRKS
KEK
>gnl|bykdb|A0A2G8DIK4 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Mesotoga sp. H07.pep.5.3] (length=736 residues).
MSEFEGSDYRELTLEDILRMFKKRMILFVSIVLAVVVVTGIYLIFATPIYEASVTIKVDPTSQSSVSDLFSSSLTGSSGS
NISTEVELIKSRTNIEEIIEVLDLVDRIYSEETKNRLLAEGYSQKDLVTSLTRTISSMITVSPVKDTRIVRVSVQNKDPI
LARDIANTLADVYNTKLAELSKRDLTRKREFIEAQIPLLESDLNEATDRIKDFKEETGIYVLDKHADLLFQMLSSYDKQY
NELMISAEEKKAEIETYQSMLDDFDSNDSKSIKALWVQTSESFSVNPVLTSLRQSLATLQVELASLEEQYPKTDPRVRSK
ITEISKTESLIEEQIQNEFITSGQGMTLNPAYQQIMTGVISSEAGFQILQASIQAVGLLRDQYQSELRSLPAKEQQLLDL
ERQIAVKESLYTLLLERLEEAKISEAAVVGNAAIVDPATVPQSAVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLDKTLKT
EEEIERFSRQPIIGRIPNIEGASEEMYVEKNPTAPSSESIKLAASNLSFTMGEGKSVAVTSVLPTEGKSFVIANLAYSMA
NSGQRVILLDLDLRRPRVEKILKAGKITKGAVDVIMGNTTVDEVIQHYADNMDFIAVGTIPPNPTIVLSSKNVDALLSEL
KQRYDKVLIDMPPAVVTSDVSLIGNKLDGIILVVRPGRAIKDGLRIVVENLKTVGIKIFGVIVNGVDEKNSSYYYHYYYY
YNEEGKRQKRRKRTKK
>gnl|bykdb|A0A2K1NSH7 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Petrotoga sp. HWHPT.55.6.3] (length=719 residues).
MENELTFEDILKIFKKRFWWFFLTVVVTVVITLIYLFNATPIYEANTTLKIDPSQQSSVADIFGTQIGSTSSKISTEIEL
IKSRRNLEKVIDNLNLMEYFQAKSENPEEVTRNSVVRTLEEMITVSPVSDTNIVRISVQSEDKELARSIADNLAIVYNDL
LKSLSQNEYTARRMFIEEQIPLAESDLNAAQDDLRNFKEENNIFLLDEEAKSILQFLVSYDQQINTYQIQMEETKIRLQT
LNDTLKSMDQEIISSETISINPVVSNLRNQIVNIQVQLAGLEGTKSPSDPEVLRLREELSQAQEMLKNEISTIVTSQVKT
ANPQYNSLYSQLIEEQARQQVLQGTIQSLTTLRNTYQSQLNQLPALEQRLMNYEREVRVKENLYVLLLEKLEEAKIAEAG
VIGTANIIDPAFVSPNPVKPNKTLTAAIGGVLGIFLGILVVFLIEYLDKRVKDENELKMIVKGYPVLGRIPHLHVDNETN
DELIVLRDPVSPISEAFKMLATNINFSNAKEPNVITFSSGGPSEGKTMTAANVAISYAQSGNKTLLIDADMRRPRVEKIL
NLKSKNEGLVNYLLRGASIEQSVKKPFETLDNFFVLPVGTLPPNPTTVLTSNEFRDLLDKMKEYYDKVIIDLPPIMVAPD
AMIASRYSDGLVLVTRYGQTLKPTLKAAIENITTSGVKLIGTVINDVNEKSSNYYYYYYYYSDDGDKSKTKRRRRKTRT
>gnl|bykdb|A0A2K1P2I4 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Petrotoga sp. 9PWA.NaAc.5.4] (length=727 residues).
MEEEKQENELTFEDILKIFKNRFWWFFLTVIVTVCITLIYLFTATPIYEATATLKVDSSKQGSVADIFGSQMTTGSSKIS
TEIELIKSRRNLEKVIENLNLVDYFRANSENPEGVTINDIIKTLNDMITVSPIGDTNIVKISVQSEDPDLARRVADELSL
VYNDLLKSLSQNEYTARRVFIQEQIPKVEEELQNAQDNLRKFKEENNVFILDEEAKAILQFLVSYDQQLNAYQVQLNGSK
AKIDALNDVLKSMDQEIISSETISINPVVSNLRNQIVNIQVQLAGIEGTKSPNDPEVLKLKEQLAQAQEMLKNEIATIVT
SQVKTANPQYNSLYAQLIEEQTRQQVTQSTIQSITAIRDTYQTQLNKLPALEQKLMDYQREVQVKENLYVLLLEKLEEAR
IAEAGVIGTANIIDSAYISPNPVKPNKTLTAAIGGVLGIFLGILVVFLMEYMDKRLKEESDVKRILKNAPILGRIPHVNY
NYDEEESKRELIVLNDPVSPISEAYKLLTTNIDFSSSKEPNVICFSSPGPSEGKTTTAANVAISYAQIGKKTLLMDADMR
RPRIEKIFELKSRNVGLVNHLLRGVPLERAIQSPIEGLDTLDILPVGVIPPNPTAVLTSNEFKIMLEKLKEQYEKIIIDL
PPVLVSSDSVIASRYSDGIVLITRINGTIKTGLRNAYDNINVSGVKLLGTVINDLNVQSSNYYYYYYYYSEDGEKKKRRK
RRTTVND
>gnl|bykdb|A0A2K1P7U2 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Petrotoga mexicana DSM 14811] (length=718 residues).
MENELTFEDILKIFKKRFWWFFLTVVLTVVITLIYLFNTTPIYEANTTMNIDLSQQSSVSDIFGTQMGITSSKISTEIEL
IKSRRNLEKVIDNLNLMEYFQAKSENPQEVTRNSVVRALEGMITVSPVNDTNIVRISVQSEDKELAKSIADNLAIVYNDL
LRSLSQIEYTARRRFIEEQIPLAEIDLNAAQDNLRNFKEGNNIFLLDERAKFILQFLVSFDQQINTYQIQMEETKIRLQT
LNDTLKSMDQEIISSETISINPVVSNLRNQIVNIQVQLAGLEGTKSPSDPEVLRLKEELNQAQEMLKNEISTIVTSQVKT
ANPMYISLYSQLIQEQAGQQVLQGTIQSLTTLRNTYQSQLKQLPALEQRLMNYEREVRVKENLYVLLLEKLEEAKIAEAG
VIGTANIIDPAFVSPNAVKPNKTLTAAIGGILGIFLGILVVFLIEYLDKKVKDENELKMIVKGYPVLGRIPHLHVDNETK
DELIVLRDPVSPISEAYKMLASNINFSNAKEPNVITFSSGGPAEGKTMTAANVAISYAQSGNKTLLIDADMRRPRVERIL
NLKSKNVGLVNHLLRGVSIEQSVKKPFESLNNFFVLPVGTLPPNPTSILTSNEFKDLLDKLKEYYDKVIIDLPPIMVAPD
AMIASRYSDGLVLVTRYGQTLKPTLKAAIENITTSGLKLIGTVINDVNEKSSNYYYYYYYSDDGEKSKERRRRSKTRT
>gnl|bykdb|A0A2K1PI90 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Petrotoga miotherma DSM 10691] (length=641 residues).
MIKSRRNLEKVIDNLNLMEYFQAKAENPEDVTRNSVVRALEEMITVSPVSDTNIVRISVQSEDKELARSIANNLAVVYND
LLKSLSQNEYTARRRFIEEQIPLAESDLNAAQDDLRNFKEENNIFLLDEEAKSILQFLVSYDQQINTYQIQMEETKIRLQ
TLNDTLKSMDQEIISSETISINPVVSNLRNQIVNIQVQLAGLEGTKSPSDPEVLRLKEELNQAQEMLKNEISTIVTSQVK
TANPMYISLYSQLIQEQAGQQVLQGTIQSLTTLRNTYQSQLKQLPALEQRLMNYEREVRVKENLYVLLLEKLEEAKIAEA
GVIGTASIIDPAFVSPNAVKPNKTLTAAIGGILGIFLGILVVFLIEYLDKKVKDENELKMIVKGYPVLGRIPHLHVDNET
KDELIVLRDPVSPISEAYKMLASNINFSNAKEPNVITFSSGGPAEGKTMTASNVAISYAQSGNKTLLIDADMRRPRVERI
LNLKSKNVGLVNHLLRGVSIEQSVKKPFESLNNFFVLPVGTLPPNPTSILTSNEFKDLLDKLKEYYDKVIIDLPPIMVAP
DAMIASRYSDGLVLVTRYGQTLKPTLKAAIENITTSGVKLIGTVINDVNEKSSNYYYYYYYYYSDDGDKSKTKKRRRKTR
T
>gnl|bykdb|A0A2K1SRT1 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Mesotoga sp. B105.6.4] (length=736 residues).
MSEFEGSDYRELTLEDIFRMFKKRMVLFISIVLAVVVVTGVYLIFATPIYEASVTIKVDPTSQSSVGDLFSSSLTGSSGS
NISTEVELIKSRTNIEEIIEVLGLVDRVYSEDTKARLLSEGYSDRDLVASLTRSISSMITVSPVKDTRIVRVSVQNKDPV
LARDIANTLAEVYNTKLAELSKRDLTRKREFIEAQIPLLESDLNEATDKIKQFKEETGIYVLDKHADQLFQMLSNYDKQH
NELMISAEEKKAEIETYQSMLDDFDSIDSKSIKALWVQTSESFSVNPVLTSLRQSLATLQVELASLEEQYPKTDPRVRSK
ITEISKTESLIAEQIQNEFIVSGQGMTLNPAYQQIITGVISSEAGFQILQASIQAVGLLRDQYQSELRNLPAKEQQLLDL
ERQIAVKESLYTLLLERLEEAKISEAAVVGNAAIVDPATVPQSPVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLDKTLKT
EEEIERFSRQPIIGRIPSIEGTSEEMYVEKNPTAPSSESIKLAASNLSFTMGEGKTVAVTSVLPTEGKSFVIANIAYSMA
NSGQRVVLLDLDLRRPRVEKILKAGKRTKGAVDVIMGTASIDDVVENYAENMDFIGVGIIPPNPTIVLSSKRIDTLLSEL
KQRYDRVLIDMPPAVVTSDVSLVGNKLDGIVLVVRPGRAIKDGLRIVVENLKTVGVKILGVIVNGVDEKNSSYYYHYYYY
YNEEGKRKKRRKRTSK
>gnl|bykdb|A0A2S5EHY0 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Petrotoga halophila DSM 16923] (length=718 residues).
MENELTFEDILKIFKKRFWWFFLTVVLTVVITLIYLFNTTPIYEANTTMNIDLSQQSSVSDIFGTQMGITSSKISTEIEL
IKSRRNLEKVIDNLNLMEYFQAKAENPQEVTRNSVVRALEGMITVSPVNDTNIVRISVQSEDKELAKSIADNLAIVYNDL
LRSLSQIEYTARRRFIEEQIPLAERDLNAAQDNLRNFKEGNNIFLLDERAKFILQFLVSFDQQINTYQIQMEETKIRLQT
LNDTLKSMDQEIISSETISINPVVSNLRNQIVNIQVQLAGLEGTKSPSDPEVLRLKEELNQAQEMLKNEISTIVTSQVKT
ANPMYISLYSQLIQEQAGQQVLQGTIQSLTTLRNTYQSQLKQLPALEQRLMNYEREVRVKENLYVLLLEKLEEAKIAEAG
VIGTASIIDPAFVSPNAVKPNKTLTAAIGGILGIFLGILVVFLIEYLDKKVKDENELKMIVKGYPVLGRIPHLHVDNETK
DELIVLRDPVSPISEAYKMLASNINFSNAKEPNVITFSSGGPAEGKTMTAANVAISYAQSGNKTLLIDADMRRPRVERIL
NLKSKNVGLVNHLLRGVSIEQSVKKPFESLNNFFVLPVGTLPPNPTSILTSNEFKDLLDKLKEYYDKVIIDLPPIMVAPD
AMIASRYSDGLVLVTRYGQTLKPTLKAAIENITTSGLKLIGTVINDVNEKSSNYYYYYYYSDDGEKSKERRRRSKTRT
>gnl|bykdb|A0A2T7N3K7 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Mesotoga sp. Brook.08.105.5.1] (length=736 residues).
MSEFEGSDYRELTLEDIFRMFKKRMVLFISIVLAVVVVTGVYLIFATPIYEASVTIKVDPTSQSSVGDLFSSSLTGSSGS
NISTEVELIKSRTNIEEIIEVLGLVDRVYSEDTKARLLSEGYSDRDLVASLTRSISSMITVSPVKDTRIVRVSVQNKDPV
LARDIANTLAEVYNTKLAELSKRDLTRKREFIEAQIPLLESDLNEATDKIKQFKEETGIYVLDKHADQLFQMLSNYDKQH
NELMISAEEKKAEIETYQSMLDDFDSIDSKSIKALWVQTSESFSVNPVLTSLRQSLATLQVELASLEEQYPKTDPRVRSK
ITEISKTESLIAEQIQNEFIVSGQGMTLNPAYQQIITGVISSEAGFQILQASIQAVGLLRDQYQSELRNLPAKEQQLLDL
ERQIAVKESLYTLLLERLEEAKISEAAVVGNAAIVDPATVPQSPVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLDKTLKT
EEEIERFSRQPIIGRIPSIEGTSEEMYVEKNPTAPSSESIKLAASNLSFTMGEGKTVAVTSVLPTEGKSFVIANIAYSMA
NSGQRVVLLDLDLRRPRVEKILKAGKRTKGAVDVIMGTASIDDVVENYAENMDFIGVGIIPPNPTIVLSSKRIDTLLSEL
KQRYDRVLIDMPPAVVTSDVSLVGNKLDGIVLVVRPGRAIKDGLRIVVENLKTVGVKILGVIVNGVDEKNSSYYYHYYYY
YNEEGKRKKRRKRTSK
>gnl|bykdb|A0A318CQN7 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Mesotoga sp. SC_NapDC] (length=736 residues).
MSEFEGSDYRELTLEDILRMFKKRMVLFVSIVLAVVVVTGVYLIFATPIYEASVTIKVDPTSQSSVGDLFSSSLTGSSGS
NISTEVELIKSRTNIEEIIEVLGLVDRVYSEETKARLLSEGYSDRDLVASLTRSISSMITVSPVKDTRIVRVSVQNKDPV
LARDIANTLAEVYNTKLAELSKRDLTRKREFIEAQIPLLESDLNEATDKIKQFKEETGIYVLDKHADQLFQMLSNYDKQH
NELMISAEEKKAEIETYQSMLDDFDSSDSKSIKALWVQTSESFSVNPVLTSLRQSLATLQVELASLEEQYPKTDPRVRSK
ITEISKTESLIAEQIQNEFIISGQGMTLNPAYQQIITGVISSEAGFQILQASIQAVGLLRDQYQSELRNLPAKEQQLLDL
ERQIAVKESLYTLLLERLEEAKISEAAVVGNAAIVDPATVPQSPVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLDKTLKT
EEEIERFSRQPIIGRIPSIEGTSEEMYVEKNPTAPSSESIKLAASNLSFTMGEGKTVAVTSVLPTEGKSFVIANIAYSMA
NSGQRVVLLDLDLRRPRVEKILKAGKRTKGAVDVIMGTASIDEVVENYAENMDFIGVGSIPPNPTIVLSSKRIDTLLSEL
KQRYDRVLIDMPPAVVTSDVSLVGNKLDGIVLVVRPGKAIKDGLRIVVENLKTVGVKILGVIVNGVDEKNSSYYYHYYYY
YNEEGKRKKRRKRTSK
>gnl|bykdb|A0A328IT51 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Mesotoga sp. SC_3PWM13N19] (length=736 residues).
MSEFEGSDYRELTLEDIFRMFKKRMVLFVSIVLAVVVVTGVYLIFATPIYEASVTIKVDPTSQSSVGDLFSSSLTGSSGS
NISTEVELIKSRTNIEEIIEVLGLVDRVYSEETKARLLSEGYSDRDLVASLTRSISSMITVSPVKDTRIVRVSVQNKDPV
LARDIANTLAEVYNTKLAELSKRDLTRKREFIEAQIPLLESDLNEATDKIKQFKEETGIYVLDKHADQLFQMLSNYDKQH
NELMISAEEKKAEIETYQSMLDDFDSTDSKSIKALWVQTSESFSVNPVLTSLRQSLATLQVELASLEEQYPKTDPRVRSK
ITEISKTESLIAEQIQNEFIISGQGMTLNPAYQQIITGVISSEAGFQILQASIQAVGLLRDQYQSELRNLPAKEQQLLDL
ERQIAVKESLYTLLLERLEEAKISEAAVVGNAAIVDPATVPQSPVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLDKTLKT
EEEIERFSRQPIIGRIPSIEGTSEEMYVEKNPTAPSSESIKLAASNLSFTMGEGKTVAVTSVLPTEGKSFVIANIAYSMA
NSGQRVVLLDLDLRRPRVEKILKAGKRTKGAVDVIMGTASIDEVVENYAENMDFIGVGSIPPNPTIVLSSKRIDTILSEL
KQRYDRVLIDMPPAVVTSDVSLVGNKLDGIVLVVRPGKAIKDGLRIVVENLKTVGVKILGVIVNGVDEKNSSYYYHYYYY
YNEEGKRKKRRKRTSK
>gnl|bykdb|A0A328PVB3 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Petrotoga sp. 9PW.55.5.1] (length=719 residues).
MENELTFEDILNIFKKRFWWFFLTVVVTVTITLLYLLNATPIYEATSTLKIDPVQQSSVADIFGVQMGGSSSKISTEIEL
IKSRRNLEQVIENLNLMEYFKAKSENPEEVTKNSVIRTLSEMITVSPVSDTNVVKISVQSEDQQLASEIANNLALVYNDL
LKSLSQNEYTARRRFIEEQIPIAEKDLNVAQDNLRKFKEENSIFLLDEEAKAILQFLVSYDQQINTYQVQLQEANVRIQT
LNSMLENMDQEIISSETISINPVVSNLRNQMVNIQVQLAGLEGTRSSNDPDVLRLKEELNQAQEMLRNEITTIVTSQVKT
SNPQYTSLYSQLIQEEAKRQVLQGTIQSITTIRNNYQNQLNQLPALEQRLMDFEREVKVKENLYVLLLEKLEEAKIAEAG
VIGTANIIDSAFVSPNPVKPNKTLTAAIGGVLGIFLGILVIFLVEYMDKKIKDEKELKSVVKDKPILGRIPHFRIEKGLM
NELIVLRDPVSPISEAYKMLATNINFSDTKEPNVISFSSSGPAEGKTITATNVAISYAQSGKKTLLMDADMRRPRVEKIL
GIKTKDGLVNHLLRHMPIEQVIQKPIEELENFSVLPVGVLPPNPTTILTSNEFKDLLDRLKEYYEKIVIDLPPIMVAPDA
VIASRYTDGLVLVTRYGQTMRPTLKSAYENILTSGTNIIGTVINDVDEKSSNYYYYYYYYYYSENSDESKKKEKKSKNP
>gnl|bykdb|A0A330PI07 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Mesotoga infera] (length=737 residues).
MSELEGSDYRELTLEDIFRMFKKRLSLFISITLAVVVVTGIYLVFATPIYEASVTIKVDPTSQSSVSDLFTNSLTGSSIS
RDISTEVELIKSRTNIEEIIAELDLVNRVYSSEARERLISEGYTEKDLVMSLTRSISNMITVSPVKDTRIVKVSVQNKDP
VLARDMANTLAMVYNKKLAELSKRDLTRKREFIEAQIPLLEKDLKESTDMMKNFKEETGIYVLDKHSDLLFQMLSSYDRQ
YNELKISAEEKKAEIQTYQGMLDDFNGTDSRDVKSMWIQTSESFSVNPVLTSLRQSLSKLQVELAALQEQYPLTDQRVKS
KITEISKTESLIADEVKREFITSGQGMTLNPAYQQILTGVITAEADLQILEASINAVADMREQYQIELRSLPLKEQQLLD
LQRQITVKESLYTLLLERLEEAKISEAAVVGNAAIVDPATIPQTAVKPNKRLSLAIGAVLGIFLGMLMVFLAEYLDKTLK
TEEEIERFSRQPIIGRIPTIEGIREEMYVEKSPTAPSAESMKLAASNLSFTMGDGKTVAVTSVLPTEGKSFVIANLAYSM
ASSGQRVILVDFDMRRPRVEKILKSTKKQYGVTDVVMGKVELESVIERYTDNMDFIGVGTVPPNPTIVLSSKNIDVLLEK
LKEKYDRILIDMPPAVVTSDVSLVGNKLDGIVLVVKPGRAIRDGLRIVIDNLKTVGVRILGVIVNGVDEKNSSYYYHYYY
YYNEEGKKKKRRTRKNK
>gnl|bykdb|A0A351HB98 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Mesotoga sp] (length=754 residues).
MSEFEGSDYRELTLEDIFRMFKKRMVLFVSIVLAVVVVTGVYLIFATPIYEASVTIKVDPTSQSSVGDLFSSSLTGSSGS
NISTEVELIKSRTNIEEIIEVLGLVDRVYSEETKARLLSEGYSDRDLVASLTRSISSMITVSPVKDTRIVRVSVQNKDPV
LARDIANTLAEVYNTKLAELSKRDLARKREFIEAQIPLLESDLNEATDKIKQFKEETGIYVLDKHADQLFQMLSNYDKQH
NELMISAEEKKAEIETYQSMLDDFDSTDSKSIKALWVQTSESFSVNPVLTSLRQSLATLQVELASLEEQYPKTDPRVRSK
ITEISKTESLIAEQIQNEFIISGQGMTLNPAYQQIITGVISSEAGFQILQASIQAVGLLRDQXYQSELRNLPAKEQQLLD
LERQIAVKESLYTLLLERLEEAKISEAAVVGNAAIVDPATVPQSPVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLDKTLK
TEEEIERFSRQPIIGRIPSIEGTSEEMYVEKNPTAPSSESIKLAASNLSFTMGEGKTVAVTSVLPTEGKSFVIANIAYSM
ANSGQRVVLLDLDLRRPRVEKILKAGKRTKGAVDVIMGTASIDEVVENYAENMDFIGVGSIPPNPTIVLSSKRIDTLLSE
LKQRYDRVLIDMPPAVVTSDVSLVGNKLDGIVLVVRPGRAIKDGLRIVVENLKTVGVKILGVIVNGVDEKNSSYYYHYYY
YYNEEGKRKKRRKRTSXDVSGNNVAFWQAMKTTY
>gnl|bykdb|A0A3B8NDZ9 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Kosmotogaceae bacterium] (length=737 residues).
MNQTNGDDYRELTLEDILRIFRKRLLLFFLVVVGVVVATGIYLFLATPIYEASVTIKVDPATRSSIDIFTAGLTGTTSSR
DIATEIELIKSRSNFETVIERLELVERIYTSFEIQEMLSEGYTQNDIEASLAKTLSNITSVSPVKDTRIVRVSVQHRDRT
IARDVANTLAEVYNEKLAELSRRDATTRREFIESQIPSVEEQVRRSSDALREFKEKTGIYVLDAQARWLLDMLSNYDKQF
NALVIELEEKKAEVVAYQKLLDEFDSPEAGALQEKWINTSHTLSLNPVITQLRNKLALLKVDLAALEDQYPATDQRIRAK
KAEIAATEKLIQEEIENEFIRTGEGMSLNPTYQTILTAVITSETSLQIIESTIQSVDMLRKTYLDALAEIPRLEQQLLEL
QREVYISENLYTLLLERLEEAKISEAAVIGNAAVIDSALIPSAPVKPNRRLSLAIGGVLGIFLGMLGVFLAEYLDKTLKS
EEDIERVASEPILGRIPLANGIRNELFVQSDPTSPPSEAVKIASSNISFTLGDGKVIGVTSPLPGEGKTTVAANIAYSYA
MSGQRVLLVDLDMRKPRIEQLLGMDDRSSEGIVDIVLDNRNVGDLIIKYAENLDVLPVGKIPPNPTVLLSSKKIAALIEG
LKNEYDRIIVDLPPAVITSDVALVGHLFDGVLMVTQPGTTLRDALRMAISNLKTSGAKVLGFVVNGVTVKTSGYYYHYYY
YHYSEGTKKRKEHRKVR
>gnl|bykdb|A0A421CJA3 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Mesotoga sp. BH458_6_3_2_1] (length=736 residues).
MSEFEGSDYRELTLEDIFRMFKKRMILFVSIVLAVVVVTGIYLIFATPIYEASVTIKVDPTSQSSVGDLFSSSLTGSSGS
NISTEVELIKSRTNIEEIIEVLGLVDRVYSEEAKARLLSEGYSDRDLITSLTRSISSMITVSPVKDTRIVRVSVQNKEPI
LARDIANTLADVYNTKLAELSKRDLTRKREFIEAQIPLLESDLNEATDKIKQFKEETGIYVLDKHADQLFQMLSGYDNQY
NELMISAEEKKAEIETYQSMLDDFDSDDSKSIKALWVQTSESFSVNPVLTSLRQNLATLQVELASLEEQYPKTDPRVRSK
ITEISKTESLIAEQIQNEFIVSGQGMTLNPAYQQIITGVISSEAGFQILQASIQAVALLRDQYQSELRNLPAKEQQLLDL
ERQIAVKESLYTLLLERLEEAKISEAAVVGNAAIVDPATVPQSPVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLDKTLKT
EEEIERFSRQPIIGRIPNIEGTREEMYVEKNPTAPSSESIKLAASNLSFTMGEGKTVAVTSVLPTEGKSFVIANIAYSMA
NSGQRVVLLDLDLRRPRIEKILKAGKRSKGAVDVIMGTASIDEVVENYAENMDFIGVGSIPPNPTIVLSSKKIDTFLSEL
KQRYDRVLIDMPPAVVTSDVSLVGNKLDGIVLVVRPGRAIKDGLRIVVENLKTVGVKILGVIVNGVDEKNSSYYYHYYYY
YNEEGKKQKRRKRKEK
>gnl|bykdb|A0A421CM38 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Mesotoga sp. H07pep.5.4] (length=736 residues).
MSEFEGSDYRELTLEDILRMFKKRMILFVSIVLAVVVVTGIYLIFATPIYEASVTIKVDPTSQSSVSDLFSSSLTGSSGS
NISTEVELIKSRTNIEEIIEVLDLVDRIYSEETKNRLLAEGYSQKDLVTSLTRTISSMITVSPVKDTRIVRVSVQNRDPI
LARDIANTLADVYNTKLAELSKRDLTRKREFIEAQIPLLESDLNEATDRIKDFKEETGIYVLDKHADLLFQMLSSYDKQY
NELMISAEEKKAEIETYQSMLDDFDSNDSKSIKALWVQTSESFSVNPVLTSLRQSLATLQVELASLEEQYPKTDPRVRSK
ITEISKTESLIEEQIQNEFITSGQGMTLNPAYQQIMTGVISSEAGFQILQASIQAVGLLRDQYQSELRSLPAKEQQLLDL
ERQIAVKESLYTLLLERLEEAKISEAAVVGNAAIVDPATVPQSAVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLDKTLKT
EEEIERFSRQPIIGRIPNIEGASEEMYVEKNPTAPSSESIKLAASNLSFTMGEGKSVAVTSVLPTEGKSFVIANLAYSMA
NSGQRVVLLDLDLRRPRVEKILKAEKITKGAVDVIMGNTTIDEVIQHYAVNMDFIAVGTIPPNPTIVLSSKNIDALLSEL
KQRYDKVLIDMPPAVVTSDVSLIGNKLDGIVLVVRPGRAIKDGLRIVVENLKTVGIKILGVIVNGVDEKNSSYYYHYYYY
YNEEGKRQKRRKRTKK
>gnl|bykdb|A0A421CPQ0 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Petrotoga sp. HKA.pet.4.5] (length=720 residues).
MENELTFEDILKIFKKRSWWFLLTVVVTVAITLIYLFNATPIYEANTTLKIDSSKQSSVADIFGTQMGSTSSKISTEIEL
IKSRRNLEKVIDNLNLMEYFQAISENPEDVTRNSVVRALEEMITVSPVSDTNIVRISVQSEDKELARSIANNLAVVYNDL
LKSLSQNEYTARRRFIEEQIPLAESDLNAAQDDLRNFKEENNIFLLDEEAKSILQFLVSYDQQINTYQIQMEETKIRLQT
LNDTLKSMDQEIISSETISINPVVSNLRNQIVNIQVQLAGLEGTKSPSDPEVLRLREELNQAQEMLKNEISTIVTSQVKT
ANPMYTSLYSQLIEEQARQQVLQGTIQSLTTLRNTYQSQLNQLPALEQRLMNYEREVRVKENLYVLLLEKLEEAKIAEAG
VIGTANVIDPAFVSSNPVKPNKTLTAAIGGVLGIFLGILVVFLIEYLDKKVKDENELKMIVKGYPVLGRIPHLHVDNETN
DELIVLRDPVSPVSEAYKMLATNINFSNAKEPNVITFSSSGPSEGKTMTATNVAISYAQSGNKTLLIDADMRRPRVEKIL
NLKSKNVGLINHLLRGVSIEQSIKKPFASLDNFYVLPVGTLPPNPTTILTSNEFKDLLDKLKEYYDKVIIDLPPIMVAPD
AMIASRYSDGLVLVTRYGQTLKPTLKAAIENITTSGVKLIGTVINDVNEKSSNYYYYYYYYYSDDGDKSKTKRRRRKTRT
>gnl|bykdb|A9BJS3 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Petrotoga mobilis] (length=720 residues).
MENELTFEDILKIFRKRFWWFFLTVVVTVVITLIYLFNATPIYEANTTLKIDPSQQSSVADIFGTQIGSTSSKISTEIEL
IKSRRNLEKVIDNLNLMEYFQAKSENPEEVTRNSVVRTLEEMITVSPVSDTNVVRISVQSEDKELARSIADNLAIVYNDL
LKSLSQNEYTARRMFIEEQIPLAESDLNAAQDDLRNFKEENNIFLLDEEAKSILQFLVSYDQQINTYQIQMEETKIRLKT
LNDTLKSMDQEIISSETISINPVVSNLRNQIVNIQVQLAGLEGTKSPSDPEVLRLREELSQAQEMLKNEISTIVTSQVKT
ANPQYSSLYSQLIEEQARQQVLQGTIQSLTTLRNTYQSQLNQLPALEQRLMNYEREVRVKENLYVLLLEKLEEAKIAEAG
VIGTANIIDPAFVSPNPVKPNKTLTAAIGGVLGIFLGILVVFLIEYLDKKVKDENELKMIVKGYPVLGRIPHLHVDNETN
DELIILRDPVSPISEAYKMLATNINFSNAKEPNVITFSSGGPAEGKTITAANVAISYAQSAKKTLLIDADMRRPRVEKIL
NLKSKNEGLVNYLLRGASIEQSVKKPFETLDNFFVLPVGTLPPNPTTVLTSNEFKELLDKLKEYYDKIIIDLPPIMVAPD
AMIASRYSDGLVLVTRYGQTLKPTLKAAIENITTSGVKLIGTVINDVNEKSSNYYYYYYYYYSDDGDKSKTKRRRRKTRT
>gnl|bykdb|C5CHA4 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Kosmotoga olearia] (length=741 residues).
MNELDNEYRELTLEDILRMFKKRFWFFMAIVIGVVVATGIYLVLATPIYEASVNIKVEPTSKSSVSDIFMNQVTGSYSSK
DISTEVELIKSRTNFEEVIRRLGLVDKMYEPEVKERLLSEGYTEDDLVQSLTYTLSEMITVSPVKDTRIVKVAVQHPDPV
LAKDIANTLAEVYNEKLAELSKRDITMKKQFIESQIPVLEEDLKKSTNELKAFKEKTGIYVLEEQARWLLQMITTYDQQY
NNLQISMEEKIAQKKSYEELLKQFDSSEDKTFRDKWLKTSETLSRNPIIQQLKSKLVELQVELAALRQQYPETDPRVRAK
LTQIAETENLIKKETEEFIRTGETQTLNPAYETALTGVISAESTIQILEARLKAVDRLRKEYEKELSKLPTIEQQLLELQ
RQIAVKENLYTLLLERLEEARISEAAVVGNAAIIDPARVPRYPVKPNKKLSLAIGGVLGIFLGMLAVFLVEYADKTLKTE
EEIERYSGVQILGRIPQIQDLKDELHVKASPISPESEAIKMAASNISFILGDKKSFAITSVSPSEGKSFIAANLAYSMAS
NDTKVILVDLDMRRPRVEKILKLNGRKTKGIVDVVLGKITLNEAILNYEGVFDVLPVGSIPPNPTVILSSKKLTEIFEEL
KKRYDTIVIDMPPAMVTSDVSMVGNKFDGVLLVVKPGTTPRDGLRIAVQNLRTVNINVLGLLVNGVDEKTSSYYYYYYHY
YYTQDGTKKKIRRKKSRRTGE
>gnl|bykdb|H2J8E1 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Marinitoga piezophila] (length=719 residues).
MEPEIYEDELTLEDIIHIFKKRFWWFFATVVVVVALTIAYLFVTTPIYEANVTLKIESGKSNSISDLFSTQLSSSRPEIS
TEIELIKSRTNIEKVIDDLNLIEYFSNKSEDKKVEITKTSVVRTLNNMISVSPIKDTNIVKISVQSDDPELAKDIANKLA
EVYNEFLKTLSKNEYTVKREFIEEQIPKVEKDLKAAEERIRKFKEENQVFLLDEEAKNILSFTLEYDRQINQYSLQLEET
KSKIKAFNDLLKKLDEKIISSETISTNPLVSQLKSKLINYRVELAGLVNVYSETDPKVKELKDKIAETEKLLKDEVSKVV
SSQVQTVNPAYQDIYLQLIEAQYQAEVLKATITALQKLKDSYNRKFSRLPLLEQQLLELERDIKVKENLYTLLLEKLEET
RIAEAGVIGTAKLIDSAIVPDKPIKPNKKLTAAIGLVLGFFLGILVIFIIEYADKSIKDEEEIKRMAKNKIILGRIPTFE
QNKEFDNPELIVLNSPTSPISESIKLTAANINYSTSPEPKVIAITSSGPGEGKTVSSANLAISYAQNGLKTLLIDIDMRK
PRIEKALGLERFNIGLVNHILKDVPIERITQNYMENLDIIPVGPIPPNPTALLTSKKFREFFNVLRQKYDKIIIDLPPIL
AAADALIVSKHTDGLILVVRAGKTQKHSLKVTLENITTSGNNILGLIINDINEKSSNYYYYYYYYYQDGEKKKRRKHKK
>gnl|bykdb|I2F2W0 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Mesotoga prima MesG1.Ag.4.2] (length=736 residues).
MSEFEGSDYRELTLEDILRMFKKRMILFVSIVLAVVVVTGIYLIFATPIYEASVTIKVDPTSQSSVSDLFSSSLTGSSGS
NISTEVELIKSRTNIEEIIEVLDLVDRIYSEETKNRLLAEGYSQKDLVTSLTRTISSMITVSPVKDTRIVRVSVQNKDPI
LARDIANTLADVYNTKLAELSKRDLTRKREFIEAQIPLLESDLNEATDRIKDFKEETGIYVLDKHADLLFQMLSSYDKQY
NELMISAEEKKAEIETYQSMLDDFDSNDSKSIKALWVQTSESFSVNPVLTSLRQSLATLQVELASLEEQYPKTDPRVRSK
ITEISKTESLIEEQIQNEFITSGQGMTLNPAYQQIMTGVISSEAGFQILQASIQAVGLLRDQYQSELRSLPAKEQQLLDL
ERQIAVKESLYTLLLERLEEAKISEAAVVGNAAIVDPATVPQSAVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLDKTLKT
EEEIERFSRQPIIGRIPNIEGASEEMYVEKNPTAPSSESIKLAASNLSFTMGEGKSVAVTSVLPTEGKSFVIANLAYSMA
NSGQKVILLDLDLRRPRVEKILKAEKITKGAVDVIMGNTTIDEVIQHYAVNMDFIAVGTIPPNPTIVLSSKNIDALLSEL
KQRYDKVLIDMPPAVVTSDVSLIGNKLDGIVLVVRPGRAIKDGLRIVVENLKTVGIKILGVIVNGVDEKNSSYYYHYYYY
YNEEGKRQKRRKRTKK
>gnl|bykdb|N1JYC6 [Bacteria] Bacterial tyrosine kinase [Thermotogae][Mesotoga infera] (length=736 residues).
MSEFEGSDYRELTLEDILRMFKKRMILFVSIVLAVVVVTGIYLIFATPIYEASVTIKVDPTSQSSVSDLFSSSLTGSSGS
NISTEVELIKSRTNIEEIIEVLDLVDRIYSEETKNRLLAEGYSQKDLVTSLTRTISSMITVSPVKDTRIVRVSVQNKDPI
LARDIANTLADVYNTKLAELSKRDLTRKREFIEAQIPLLESDLNEATDRIKDFKEETGIYVLDKHADLLFQMLSSYDKQY
NELMISAEEKKAEIETYQSMLDDFDSNDSKSIKALWVQTSESFSVNPVLTSLRQSLATLQVELASLEEQYPKTDPRVRSK
ITEISKTESLIEEQIQNEFITSGQGMTLNPAYQQIMTGVISSEAGFQILQASIQAVGLLRDQYQSELRSLPAKEQQLLDL
ERQIAVKESLYTLLLERLEEAKISKAAVVGNAAIVDPATVPQSAVKPNKKLSLAIGGVLGIFLGMLMVFLAEYLDKTLKT
EEEIERFSRQPIIGRIPNIEGASEEMYVEKNPTAPSSESIKLAASNLSFTMGEGKSVAVTSVLPTEGKSFVIANLAYSMA
NSGQKVILLDLDLRRPRVEKILKAEKITKGAVDVIMGNTTIDEVIQHYAVNMDFIAVGTIPPNPTIVLSSKNIDALLSEL
KQRYDKVLIDMPPAVVTSDVSLIGNKLDGIVLVVRPGRAIKDGLRIVVENLKTVGIKILGVIVNGVDEKNSSYYYHYYYY
YNEEGKRQKRRKRTKK
© 1998-2019