BYKdb

Dataset for cluster orphancd of phylum verrucomicrobia

[Download (right click)] [Alignment] [Repertoires]

162 sequence(s)

>gnl|bykdb|A0A0E3YV65 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium IMCC26134] (length=709 residues).
MSPREILLSIRERALTSFVLALLICSLLGGWLLSRPKVYQSRSRLLVDRSERVVDIAQVVDQSVGGGKNDAMFDTYLAQI
TSPAMIVRVVDSLSETEKLSAWRPYAEQDAPPPAAPVLRDTLLQIIGSSVSAARQGNTFFISINVLQRDPDSAALLASRF
ASQFIIHLLDRNSAVNNSAIAFLREQTQELRVKAESSERALQQYREKSGMVSLDESRNIVVDRMKALSSTVTGARVSRVT
IEARLNQAEFIMAGGGDPLELAAATEFANLSAVQSQLDTLRTQRATMGERYGVRHPSMIENDRSREALERLRTELITAAM
SNLRNQRAKALNEETQLQSQLAQAEKESFRLDEMAVQFNVLRREAETNRATYAQLLNRLNETSITAQLANSNVRVADGGT
PAGLPLEPDPRKIAITLLVLGLGVFVAYPVALELIFNRVKGWSDVENYLGLPLLAELPLLNKIKTEFLPHLLTRAADQDA
AETIRNLYGQLKAGSRLDLPKILLVTSTLPGEGKSFVASNLAASFASHGIKTLLVDTDFRRPTLHRYYGQSNDAGLLRWL
DTKSKTEPALLRDPALGITAFGPSLHLLRSGGTTRRSTEILDSAAFRDLLDFLHKQYDAVIIDTPPAGVFSDAMVLAEQA
GELVFVVRYNYTSRPGVRRLIETFKRSQIDLAGIVLNRMPAGTHSDAYYSSYGHYGSKYAADYIREEKA
>gnl|bykdb|A0A0R2XPB1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium BACL24 MAG-120322-bin51] (length=722 residues).
MDDLFQDENNTKTVDYTELFQQIVYRAKIVLRRYWWVIPLAITLGVSYKAVESFVADPFYKSTSQMIVSGRIALPENDMY
AEERDNFIGTQIELMLSDQVQARAVERIRLMDPDLHDALIATEAYQIDGLRALSIESNVKRDTSIFVLSAYTPHAEYTQA
YLDAVMEEYINRRVEMRSKTSARTYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNIVFIQEQGAAASTYLAELKRELAELN
TENRVLTSILNVDAVKMSLLLDQWQGAEDTSSATTGGSAGDNQSYQLSKKQLQVLHAQLDEFSIYLQPKHPKIIGLKNQI
ERTENQLEIQRDQTLRRIRERQSVLNNTAANLTLEIAIWEKSALEHGRLIAEFERLQSRLERSKAASVNSQDSLQAIDTN
QNLQQETVSILVNARKPIPAGVGLVQQFAMGALFGVVLAAGILFVLAAIDNRILTASELSAQFKDPLIGVIPFEVNHDGD
VNSVLLRKNDDRYVFAEACRNLRTSVFFMGDEHVKPSVFAVTSAIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRGRL
HHLMQLNRENGFSDILEGSLTLDSAVQSSSYEHLDFVSIGGYPDHPAELLMSKYMDQFIRDARAQYDFVIFDTAPILATD
DTCGFAAKMDAVLFTIRCAHTQVRQIKPAMARLRERKIDISGLILNYVDTTQPGYYYYKYSEYYTDPKNGVQSTSQQTTA
SS
>gnl|bykdb|A0A178IDB9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium TSB47] (length=739 residues).
MSKPVQAQTRSTAHRSAARVPDQAQAGGNLAHFSPRNLLNMFLERWWIGLIAGAAIATVFILAQPKLAPVYRSEVKLLFE
PQKDQVIGIKEVVDTTTTSNLQLNLHIEQMLSTTFYEYVQSSFSSAEIEQIQAPYRNPDNPSAPPPSLAGIIRPHINIYQ
QKGTTIVRIVVTNRDPEAAALIANRFSRKYIDFTVDKAMTSTNSAIIFLKNQSEEKRSEVESVERAMQDYRARHNMAALG
EATNIVRQKVGLLGNDLAQAQLEQTTLQTLIQLIEDYRKRGQSLYEISAIIGFGNVASLKTQYENILAERTALAERYLEE
HPRMRQNALALADTRARLDAAVDLAIAETHARLNLARQHEQRLRSEYAAAEKQAQDLDRITIDYKFLEEDAVSKRQAYNS
ILSRLNETTIVSQLENVNIKVLDKALVPGAPSNSPSSQILLQAGAFGFILFLGLPIGIGLMDTRVKSSHDVETGLDHPLL
GGIKTMKKLTEAERPNVFRLHKDDALAEAYRGIFSEIEIRSPVPFPKRILITSSVPGEGKSLTASNMAAVFAAHGRRTLL
VDCDFRRPSLRRYFGTAPGTGLLSWLRAHPDDGADTPLDLATLGIATVENNLHLLPAGHAIKNPTEIIDQIAHSELFNKL
SKSYEVIIIDTPPAAVFPDALLLSRFCAELVYVCRFRTVRRKLIKKTLSKFTESGISILGVVLNRMPHASIMNYGYDGYG
AYGSDYYKAYQEEEAAAVK
>gnl|bykdb|A0A178IFJ2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium TSB47] (length=753 residues).
MAETFSKKPVPAAGAWPPQSSSPFGEPPPFAGGSLPRLDIRQILLCIRERWIVAVSLAILVCVLLGVWLLNQPKVFQASA
TLLVDRAEKVLGNEMTKVVDDSVGGSKNDPSFDTHLAQITSREMVQRVVASFTPEEKTRVLAAWLDKDDPPLSASQMDGR
LSGLITSGVGVQRQGTTFLIRITCKHREPAMAALVATRFAECYIVYLMDRNASANDSAISFLRAQTEDLRKKAEASERAL
HAYREKSRMVSLEESQNIVVDRMKAISSALTEAQVALLAIEARLQQAESVIAKNSSPLELASITEFSSLASVQSQLDELV
ARKAVMAEKYGRRHPAMIDQERSIQALEKLRGDLILTAVANLRNQREKALENERQLQRQLADSEKASLALDRQAVEYNVL
RREAETNRATYTQVLSRLNEASLTAQLGNSNIKIAERARPPTVPLEPNPKKILLSIGFLGVLIVIGYPVGMELLFNRIKT
WTDVERYIGLPLLSEFPVLKNLPGDTLNHLVLQDRDPDAGEVVRGLYAQLKLSSRLDAPKTLLVTSTIPGEGKSFVASNL
ATAFAAHGLRTLIIDGDLRRPVQHRLADAPNTHGLLRWLDKGGKSGGPLANDPDLDLLRPAPNLFVLRAGGTSRRISELL
DNEKLKGLFEQARREFDILVIDTPPAGIFPDAFDLVPFASELVYVVRFNHVSRPQVHRVTERFRSTGLEMPGIVLNMMPS
GRGSAAYYSGYGYYGSKHYSSYYKEGQLAARSG
>gnl|bykdb|A0A1G3ZL71 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8] (length=728 residues).
MPSPLAIPAAPAKPSASTRAPQGGEEHLVERRTLRDYYVIIRERLWIALPLALLVSLGLGYWKMRETPMYESRATLQFER
EERVMNQQKVVELAPQSEVDINTYVHQLNSGTLRSRVYDSFTPEEKAILQRSFLKDLPPGAGPPATGDFMGQVVADAVRG
SRLIRITARHRDPAAAALVANRTYQQFVNQLIENAGGSSEFTVEFLQLRATELRKELGEKEALLQDYKKRHNLISLDDSL
NIVADQLRRANEARTAARHERLRVENLFRQVEAYRQNGRDLLELSEITGYGNIPALRNQLSELLQTQKVLSDRYLERHPR
MIELARQIATVRADLEKSIQLAVADLSASLEKARDGEQTFEKEYAQHEKDQIKLNELKPEYGSLENEALAKRTAYLQVLD
RLNQTTTSKNLDSRVPLRVIDRATPSHAPYTPNLARVVRTSTIVGLLIFFGVAFGLSVVDDRIKSAWDVESYLGVHLLGI
IPELAHVATDSLHTLAILSKATPGVESFLSVYSAVKIQSKIDYPKVILVTSTIPGEGKTLVSCNLAGSFARHGRSTLIID
CDMRRPMLHRHFKMENDAGLLAWAEAGASLDGDLTTDPKLGLARIADNLMLLRSGGRSKVPTELLEKPEFGELILQLKKR
FDLIVIDSPPLGAVTDSLLIAEQTDEVIYVCRFNRALRKHIKVFVRTLREGKNAFLGIVLNGLTARRIAYYTNYRYYRSY
KKYYGTQG
>gnl|bykdb|A0A1H1SWX2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutus sp. GAS368] (length=727 residues).
MSAPDAPLPTAPARAPGPSLHGNDQQVVEKRSLRDYYVILRERLWIALPVALLVALSIGYYQAQEIPMYSSTATMQFERP
ERVVQNEQVVDTAVRSEVDLGTYLQILQSGRLRTMVAQSLTPDEIRLLQRPYLKDLAPGANPPAVGGLLGSMSPLSIRNS
FLITITVNNRDPEGAALLANRFVEQFMRYLMENVGGKNEFAVDYLRSRAKELQQESEAAEGKLQDYRRKHNLVSLDNSMN
IVGERLRTVNATLTTARLARLDIETLLSQIEKMQKENPANLLEIGYISAYGNIPVLKNNLAELNKQQAILSERYLERHPK
MIELANSIDVVTAQITRNIEQSISDLRTQYVKLQDTEASYIKEYQAAEKDNLRLGDLSVDFKSLENQAQVAKSNYLEILN
RLNQVTTSKNLENIPVKPLDRALPKGSPDTPNIRNIVKTSIGLGLVVFAGVAIGLSFLDDRVKSAWDIEGFIGAHLLGII
PELGDVPDTEKHSLVNSNRTSPGSEAFLSVYSAVKIQSKLDFPKSILVTSTIPGEGKTMISCNLAGSFARHGKKVLLIDC
DMRRPMLHRHFKLTNEAGLIAWFEAGAKIPADPFTDASLGFTKVDENLFLLRSGGRSKSPTELLETAVFGQFIEAMKQHF
DLIVVDSPPMGAVTDSLLIAERTDEVIYVCRFNRAYRKHIRLYIKQLKESKNELLGIVLNGLSPRRIEYYSNYRYYRSYK
KYYGSQS
>gnl|bykdb|A0A1H2DTI1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobium sp. GAS474] (length=737 residues).
MEPIPPSAPGTPGGFPPPQAPSSPMTAAMSQAGGRVPGTFMSRLHRYKLLVKKFWWILLFCTAVGIAIQAYKIAHEVPNY
ASTARLMINTKINVTESSVSTTEVGNYMETQIALMTSQKVYTAAINALKAKNPGFVESDVRIDVHPLGSTPILIIRAMSS
DAQFAKDFLQADIDAYIALQHDIKVDDKDRAIKDITDELTKAEATLQTDEDDVLGFQKANNIVFLQEQGSSLGSHLAQLN
NQLVDRRNEYDLLVKLTAKQGDLQGLPVVAGASNSQQESRMRLAAATTEFFKAQQKAQERITELETQMKEEEEYLRPAHP
KRVALAAQIADLKRSITLSKEQNIEEANVRRETLALEIQHLEAMVKEYEPKAISLGAKLAEFERLKSKRSMDQSLYESLL
QSVQKIDLNRRLDEQRFTLMEPPSDATSIKDQYQVRLLSAGLGGLIVGMAILFIIDRFDDRINSTTELRDYFSERILGQM
PFEVSLGDRSNRRLIQPGDDRHTYSESFRNLRSALMFMEVDGARPRTILFTSASPDEGKTTVATNFAITLAMLEGRVLLV
DADLRRGGLNRLLDIDAPLGFTDVLLHGADWRKAVVPSKHKNLSVMVCGKYTSQGAELFLSPITDGILREMYNEFDYIIF
DTSPVMAADDATSLAPKIDGTIFVLRASMTSARAARNALDQLYHRQVNVLGLVLNSVNALLPDYYYYYRYYEYYRPKDEV
IEGAPGTPRRGKDGSKL
>gnl|bykdb|A0A1H2GQN6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobium sp. GAS474] (length=729 residues).
MSVSESIDLPHFNDYWRVIRARFGIILTLFILTFGTGYFVSAFVLQKQYGGTVDIRVFKQDKDVQVFSQSDRNAFDPIFF
ESERSTIESKEILYPVIKKLNLVEKWSQRYLHGERLLREDEVYGILLGRHLKVEPQRGSNIIQITGISEEMEEAPLLANT
IAETYIGVRTKNEKDRINRGLDNVADQIEKQRTIVTDAKKKVDDMRLQLGVDIIPGTQNESQLLDQELEGKQKQLDDARQ
DAVARRVRYEQLKNLSTEDLIDTLPSLGLNDANIDQIRQQELQGSANIQSLLKGGFGEEHPRVQSLRAAVGRAQEQLKSL
AEGKRRALLIDLNVSEEKLKLLEADVASLRDKLRQEKSDKMAPFQEAVKERDRQQYILDQYEIRYKQENLDQQSPSQPAT
VISPANTNPNPVRPILWLNITLSGVAGLLLGLSVAFFIEYLDTSVKSLNDVEKTLGVPVLGIIPRGVKPLNKEPKDTPHA
ESYRILRARIDLQAHSGPGNTLTMISGGPGEGKSTTLFNLAHVCAEAGQSVIILDADLRRPSQHTILDIASGPGLADHLI
RGVPIADLIRETAIPNLHIIPAGEDAHDAISRFDNQVLREIIVELKEKYQVIFIDSPPALGVSDASVIAHEVDKVVMVIQ
HRRYPREISIRTKKAIEEVQGNLVGVALNSVATNSDEGYYYYGAYADYYNNPKNRKKKKKGSSLQPRPAPPLPPGTTPPP
TPPSQPDEF
>gnl|bykdb|A0A1T4WVZ9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Prosthecobacter debontii] (length=730 residues).
MRETSNELQQQALDSWQVIRNRFGLIILSFLLVFATAAIITYIMPRKYRGRVEMKIERLQNKVQVFQRNTDDFMAPTDVV
IKNEFESITKPETLYPVVDKLDLQKRWSLPNRQSALAKLRGNLDTQSSVRSDFVVIEYFDQDPGVAAEIANAVYQSYMTR
RVEVETSQKQEALAMLAKQIAEQEQLRDQARLKMQEAKKKGGIVGEWFSSGTNSTAPGANLRTTEDSMVVTREQALLNTE
LEVQALQAEIAELSKLSDEELVARSSGLKLENANVTNMLAELTRLQVTREGLVNAGRGRRHPEVMGVDSQIALSKQLILD
AVKAHLAALQTRLDFSIQRRETLRSSNEEAKSEMLDQQSAQNDYKTAADDVAYIENLLLQLKSSYFETKAGLELVKSPAT
LYAKAEPEGKPAKPNVALNLALGGVLGLMLGVGLAFFLEYMDTSVKSLDDVERFLGVPVLAVVPKDVAVLHRTSGFNPDA
EAYRILRTNIEFNRKNPDANCITVTSGGAGEGKSTTLCNLAFVCAQGGYSVLLIDADLRRPRMHTLFDVSNAVGLTNYLT
TNVTLEEVVVRTPVENLYFLPSGMLPADSAGVLNSQRMTELIEDAKSRFDIVLIDAPPILGVSDASVLANEADLTIIVVQ
HRKLPRHMLLRVKQTIENVGGTVLGVVLNNVDLRSDSQYQYYTSYYTYYSPNNTAAPAGTRPEKRKKQIPPSRPGQATVA
SSSAPRGDLF
>gnl|bykdb|A0A1T4WWY4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Prosthecobacter debontii] (length=746 residues).
MNSKTQPSGKDSKLDGSSIIRTVLAYEDYWRLMIILVLIGLLGGTCYFIYARATYESQALIRANSFLMSSEAAVGNANAD
RTYRQMRALMDQLNSGYVILEAARAIGVAGPSTTFDGLRDDVMPVCRMAILDQSHFQILVVSYDAEVVKKMPQALVDAYE
RIRLKIRSEYRDTAVKRYADEVTEIRKKVAEQLDSRLQFEEQSALANAQIEMERLSNIPVDIVRAKYRLKEHEEISRILQ
EQQSSLDVIGKLSLISGFTDEEKDPLEAGRVVRKGGAVAPFTFSSPSTDKKFTQVVVQPNMVDGLKSWQELERTKRATEE
KLRLIQTKFLDDHPEVIKLKDELKQVESALDIELKVALTSFDLEKARLTEKLEELDGKLPEYHKAIKSYDTKKLDYDLME
KSQLAWDKAYEKLSQRIESLEFDGDKAPLSLEFRGFTNLRSEMPVSPNKSKLFMMGCLLGLGLAGGVPFLLRRFDSSVVE
LSEFEGTLGINGIGLVPLSDPKELESLNRAPTVGANVPNALLENFRLIRSSILLNGSPKGDGRVIMLTSARPSEGKTTVS
SNVAWAFSSLGEKTLLIDCDLRRGRVHEVIGASNAVGMTDLLTGRASLSECVQKVEAENLWAITRGMVVPGTTELLNSGV
FAAILEELKKKYDRIILDTPPVLGLSETAFLQHHADGVAIVVRCGKTLRKDVEDAVQSLQKLGAHFYGFILNGVDFSKRV
NHYYYYYYSASYYDANWDVKPAKKET
>gnl|bykdb|A0A1V5L462 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium ADurb.Bin474] (length=706 residues).
MQDDFLESSGREGGHTDLGETLRSLSHRARLLLQSYWWILLLCLSIGLLVQAVRVKSMRDAWESSAQLIIQGNIEIQEAD
RLREVATNFHDNQLHLMTGQWVSERASERVRALHPEIQKDWVSLWAGRKGTTDIFQLVASGGNARYTQAYLAQIIQAYLE
FRRQTRLETSDDVMLSIGEELRELDVKIQQIQEAIRRFQQENNTIAIKELSEKAAGRLSELKTRLEDYRTQLRILESFDE
NVSLDQIQDVVNLDTIESSQNYRNTKRQHQQLLAMKEQFGIYLKPKHPRMMDIEAELEILSNRIRIFRAQAFGQIEEEKS
ALRNRIDTLLPEINKWEEEVIQYSLGVADLETMNSNLSRLLSTRESLIRRKERLDIGRNVDTELISVLVPATSAVLRQVD
KRREIAKGGALGLGMGAAIVFLLAALNNRITSADDLRRMFSSKVIGLIPQTKAKITVLRKEADDVFAESFRALRSSILLH
RQDSKEPRQVFLVTSCAPAEGKSTVSSNLAVTLAYSGAKTLLIDCDLRRGHLHNKFGIDRDPGLAELLEHPEMDVQDVIL
VGDQELGNLSVISAGRPQENPGDLFLNERMDAILEACRKQYDFVILDTAPILAVDDTIGLLRRADDVIFVVKSGQTNFRQ
VKISLERLSVTKTKVWGFVMNYVKAGGNDYYYYGRYKSYRYQHKESGDSGNEEIRKKTGRLSPKEK
>gnl|bykdb|A0A1V6GCZ3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium ADurb.Bin063] (length=587 residues).
MRGTSLIEIVVYSEKPEEAARIANAIADAYKTHRQEQRAQLSRGGIKALEERFAEQEAKVKAAQERVDNLRKELNISDAM
ASGDGPSPLMTAETLRKIESLRIESQAEYVRQATRLDRLKNLGKELGPEGLAQAITTDAPDTLLTSLLDQLTMAEQRLIA
LEADYGPENTEVLKCKGLAEDLHKKIKSRVEGIMLGLDTRVLSLSNSLVNLQQEVGRATTNDVTQANLTRPYFEAKRALE
ELQRFRQVLDAKIAFEKIDVELPKTLMVEVVDRAMPGLRPVRPNKPLNIALGIIIGLVVGVGLAFFIEYLDTSVKTIDDV
ERALQCPVLGVIPQNVGLLVDEGTESPHAEAYRVLRTNLLFSRKDDKLNTIAIVSAGAGEGKSTTVFNLAAVFAQSGQRT
IIVDSDLRRPTLHKMLRVTNAIGLTNYLLRQNTLEEVIQTTSLPTLDFLSSGKLPSSSLGILSSTQMKDLIGELKQRYDF
VFFDSPPIMGVSDASILASEVDMTIQVIQYRRYPQPMNIRAKQLIEKVGGNLVGIVLNNINMSQDESYYYYSGYYHDYYY
RSEEQEPVVKEGAESGGKDKLDIKQKY
>gnl|bykdb|A0A1V6GL40 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium ADurb.Bin063] (length=732 residues).
MNDQPVQSFHDRPNTAARLHARLSRFRNLLREKWWVLVLGAMAGAIIKIVLLWNAPPSYVSVGRMIVSMKLAIQPASLYS
EELSNFLGTQAALMQCGVVVNRAHERVSAQKPEIGRHAVALNVLVLPKTTIFVLQATGRDRDYTQAFLQACMDEYIALKK
EMRSQTSDTTVAGLTEQVMRLEKDLRRAEAEMVQFQSTNSMMLTQEQGNSPAHYLTTLYQRLVTLKSEYALLQRLTLDQN
LARRQAAGGTFSLGNEPLAEGNDSLPDTNAVALTAGGTPGQSSTAAGDRGDTAYLQAQQQLLLLRVEQQELGRYLRPNHP
KMIAMQEDIARREELLKILRTQSEEQLKNRKELLAVEIEILEKDLKAWDARNQEFQHKNAEYQALKANVQRIRALYDQLL
ATMQTLDVNKEISPESVETIEAASPAYAARLDLWKGAVNGALLGLALGLGLLLVLDRLDDRVGSFTELQDLFDENVLGQV
PREKLVASKRQPSLILPEDTRHSFVEAYRNLRSSLLYMTEAGNRPKTILVTSSVPNDGKSITAANLAITMANAGSRVLLV
DADLRKGTLHRLFGVSPEPGLSDVLAKGTAWETTVSATKIANLHILPAGTFTARSSELFISEATQRFLRDAASRYDYVIF
DTVPVMAADDVTCLAPQIDGVIFVLRAAFTSARVARASLESLYQRQVRLLGLVFNAVRPSSEDYYYYRYKDYYRPYPSGG
TKTAESARTGQA
>gnl|bykdb|A0A1Z8RG47 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium TMED40] (length=758 residues).
MDDEIDTTEIHSGGRSKSNIKGVSDFILIIRDRWLLALTVALPISLGFVYNKLQSPEFYKSSSSFRLIPPPAILNLQKVE
RDQHVQGLVAKHLDGLNSQELRVNVIQKVKDNPEYKSALLEPYLKEGISMDVGATVSYGVSVSPPSEGRPRFTINSNSRS
GKGAMIVADIVQSEYEKLHRSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSGYKKNNQLPFLEDEKKDTADRKSRYQA
EITKCKLEQIRINSLLRQILQIQMRIGNETSSLQSADVAGDIAVIKEFFELDAIESYGNIPSLRQTLYNLELTRKNYQET
GTGYLERHPKMMENARQVLEVKQSLNLAVKSAIEDLRDKYIHLVAQENEFAKAMQKVQEDSRKLSEIEEKLINFERQLAV
VRKSTDQIHDRLNDVRIEQALPSEQEEPLHKEQFATQPSAPYTPDKNQIRQSGFMIFFSVFFALPILLEFVDNRVKSPWD
VEVFVGHDLIGGIPKISEVDERERPLIVGNDLDDGLTESFRSMYSRIQMNSNADYPKVLLVTSAIPSEGKSLISANLAFS
CANHGRKTILIDFDLRRPGLHNLCNITNEKGIVTLVNEVVKGSKDIDTHIQESLHETHPNLHVLPSGGKTRAATEMLERA
EFDLVMNKLRQIADVIIVDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVAKSLLENIEETGANVLGVVLNDLPQKKT
PGYYYSGYYGYGYFRYKYYNKYYGKEKDEKAPVEKLTS
>gnl|bykdb|A0A1Z8RJJ5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium TMED40] (length=758 residues).
MDDEIDTTEIHSGGRSKSNIKGVSDFILIIRDRWLLALTVALPISLGFVYNKLQSPEFYKSSSSFRLIPPPAILNLQKVE
RDQHVQGLVAKHLDGLNSQELRVNVIQKVKDNPEYKSALLEPYLKEGISMDVGATVSYGVSVSPPSEGRPRFTINSNSRS
GKGAMIVADIVQSEYEKLHRSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSGYKKNNQLPFLEDEKKDTADRKSRYQA
EITKCKLEQIRINSLLRQILQIQMRIGNETSSLQSADVAGDIAVIKEFFELDAIESYGNIPSLRQTLYNLELTRKNYQET
GTGYLERHPKMMENARQVLEVKQSLNLAVKSAIEDLRDKYIHLVAQENEFAKAMQKVQEDSRKLSEIEEKLINFERQLAV
VRKSTDQIHDRLNDVRIEQALPSEQEEPLHKEQFATQPSAPYTPDKNQIRQSGFMIFFSVFFALPILLEFVDNRVKSPWD
VEVFVGHDLIGGIPKISEVDERERPLIVGNDLDDGLTESFRSMYSRIQMNSNADYPKVLLVTSAIPSEGKSLISANLAFS
CANHGRKTILIDFDLRRPGLHNLCNITNEKGIVTLVNEVVKGSKDIDTHIQESLHETHPNLHVLPSGGKTRAATEMLERT
EFDLVMNKLRQIADVIIVDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVAKSLLENIEETGANVLGVVLNDLPQKKT
PGYYYSGYYGYGYFRYKYYNKYYGKEKDEKAPVEKLTS
>gnl|bykdb|A0A1Z8SVB5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium TMED44] (length=226 residues).
MYGKIQMNSNVRGSRSILVTSAIPSEGKSLISANYAHTCANHGSKTILIDFDLRRPGLHNFCNESNDAGVMTILNTPNAT
EEQISEKIEKCLCNIHPNLFLLPSGGKTRAATEIIEKKEFELLLAAXKKMADVVIFDSPPAGLFPDSIALARKTDEVLFV
TRYGKVSRHVVKRLIGDLKITGANILGVILNDLPSKKATGYYYSGYYGYGYYRYKYYSKYYSPDXA
>gnl|bykdb|A0A1Z8VL41 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium TMED60] (length=755 residues).
MDDNFEDIDRPLSTKPKGRIRGISDFLLIIRDRWLLALTLALPIALGFVYKELQVPEFFRSESSFRLXPPPXIINLQKVD
RXSXINTLXSRHLDGINSQXLRVNVVQKISENPEXKSIXLAPFLXEGXPIGVAXTVSYSVSVTPPSAGNPRFTISATSRS
ARGAQIIADTVQLEYEKLHKSRKSEKVESARNLLELLLENRQSEEKRIAQEMSQFKKGKNIPYLEDAKNSIFARXSQYQS
EITRSKXXQXKITTLLKQIINVRVNIGVQNESLKSQDIETDIAMIKEFFEIDAIESYGSVPALRKNLFDLEKTRRDYQEL
EPGYLERHPKMLSNAKQVKDVKKALALEVKSAIDDSRDKLLELQHQEGEFTMAMQEVQSQSNELSEIEERLEDYKRELSV
VRASTDQIHKRLNDVKIEQSLPSEQDDPLHKENFASLPGGPFSPDKNAIKQKGLXIFFAVFIIVPILLEFVDNRVKSPWD
VDVFIGKDLIGGIPQISQVEETKRPLIVGNDLDDGLTESFRSMYSRIQMNSNADYPKIILVTSAIPSEGKSLISANLAXS
CANHGRKTILIDFDLRRPGLHKFCSITNDNGLLTLINEAKNGVENLRELTDKTLHPIHDNLYILPSGGKTRAATEILESA
EFEMVTNHLKSLAEVIIIDSPPIGLFPDSLAIARKAEEVLFVTRYGKVSRKVAKNLIENIEETGANILGVVLNDLPQKKT
PGYYYSGYYGYGYFRYKYYNKYYGSEKDTSTKIEV
>gnl|bykdb|A0A1Z9KB52 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium TMED175] (length=292 residues).
MGXXLVIPIALEVIDNRIKSPWDIETFVGEDLLTGIQKISEIDELRRPKIVGDDLDDSLTESFRSMYGKIQMNSHATGSK
SILVTSAIPSEGKSLISANFAHTCANHGSKTILIDFDLRRPGLHNFCDESNDEGVMTILNTPNATEEEVTDKLKKVLCSI
HPNLFLLPSGGKTRAATEIIEKKEFELLLTCLKKLADVVIFDSPPAGLFPDSIALARKTDEVLFVTRYGKVSRQVVKRLI
GDLKATGANILGVILNDLPSKKATGYYYSGYYGYGYYRYKYYSKYYSPTEDT
>gnl|bykdb|A0A257LYL4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium VVV1] (length=241 residues).
RTNIEFNRKNPEDNAITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDGDLRRPRLHTFFDINNSVGLTNYLTTELMLE
DVILQTPVDNLYFMPSGILPADAAGILNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMIVVQHRKLPR
NMLMRVKQAVENVGGHVIGVVLNNVDVRSDSQYQYYTSYYTYYAPAESQSAAQLGPVAPQGSAVAPAPRSQPAAKGDSEL
Y
>gnl|bykdb|A0A258AXL1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium 12-59-8] (length=528 residues).
EKLALLAKYRSAPLPVGTIVRREPNPDPFLIKTAGPNVVPGATGEQVNGANTARRLSPEVGAATPEASTTTIVTPQVAKR
ANEWEYIEGQLHSSEREYERLSNSLLPGHEKMRELRKQIENYQFSLDAEWKKQIASFHLEKEHLQQRLESLQDKLPEYRK
LIAGYDDFRRDYKLQSSGHLAWEAAYVGMKGRLAAMDYTGPEVQVEFQFKGFTDVRDDIPVSPNKQKLLTYALALSIGLG
LGGPVLTERLRFTSSFVGEAEKYCQYPACGIVPLMEIDDRRLVPQLPDGKESDAKVTTHANESFRIIRSSLPFYALPDNP
KQVIMVTSARPNDGKTTVAAHLAKSFSDSGERVLLIDADLRRGTLHKAFNLGNKNLGLMEILADRVKWNDAVRSSGVENL
DFISRGNDSARGHDLLSSSRFKEFLDALKHHFDRIIVDTPPLLGLADSLLISKAVDGLIFVIRADQTTQRDVATASEILH
QSGAQVYGFVLNCVNLRRLENNYYYGHYYSRYYEPTYYNNPKEGGEAA
>gnl|bykdb|A0A258AXR6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium 12-59-8] (length=732 residues).
MNESGTELQKHAMDTWQVVKNRFGLIALSFLLIFAAAAVLTYIMPRKYRGHVEMTIERITQDINVFDRNRGDSLAFTQEY
IKTQFETITKPTTLYPVIETLELAKKWELPNRQAALGRLRANLETQSMLRSDFVTIDYYDQDPQLAATIANEVAKSYMTQ
RNNIETGKKHKALEVLQQQISDQEGLRSQAQVRSQEARRKAGIVGDWIVGGGSSLNPGGEMRSEKDSMVISREQALMIAD
QEILTLQSEIDQVSKLTPDELIDQASGLRLENQNITAITVKLQDLKVAREGLVNEGRGRLHPQVLSVDSQMAEYQSLILG
AAKAHVAGLQNRLDASRKKRESLKIYNDDAKQELQNMSSLYTEYKTAKDEVTYLEDLLVKMRSRYFEEKAGIELVKSPAT
IYSDAEPEGKPAKPNVPLHLALGGVLGLMFGLGLAFFLEYMDTTVKSLDDVEHYLGVPVLAVVPKEVGVLHRSSGFNPDA
EAYRILRTNIEFNRKTPDANCLSVVSGGAGEGKSTTMVNLAYVCAQGGYNVLLIDADLRRPSLHTHFDVSHATGLTNFLT
TDIRLEDVVLRTQVENLFFLPSGLLPADSAGLLNSQRMVDLIAEVKSRFDLVLIDSPPILGVSDASVLANLADMTMIVVQ
HRKLPRHMLMRVKQGVENVGGKVVGVVLNNVDLRSDAQYQYYTSYYTYYSPTNSPNGGTGGKSRRRKIKAETTATALGSS
QSVSRLDGDDVF
>gnl|bykdb|A0A290QD69 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=731 residues).
MSKSTKSSSGKRGSSEQPQTKPAGGGFSPKSLLNMFLERWWIGLIVAAAVAAAFVLSQPKPEPIYKTEVKLLFENQKDNV
IGMAGVVETTTNSGMQLQLHIEQMLSRTFYESVQSSFTPKEIEQIQNAYRNPDSPTAPPPSLADIIRPNVRIEPQRSTTI
LRIMVWNKDPEAAALIANRFARQYIQYTIDRAMTKTSSAMLLLRGQAEEKRTELQLIERQKQDFRAKHNMAALGENKGVV
QQKVTMLGNSLAEAELRQTNLRTLIESVEDYQKNNKNILEISDIASYGNVSEMKTRIDTLRAERRQLDERYLSEHPRMKQ
NQLAMEDAEAGFKSAVDLAIAELKNRFNFAKQHELRLRTDYAETEKQAQELDKITSEYKYIEDESNIKSKNYQDILSRLS
EISIISQLDNVNITIHDKALVPGFPDTGTPKEVIKQAAALAFVLFFGIPVGLGFLDTRVKSSHDVESGLNQTLLGGIKAM
KKLSETERPNVFRLGKDEALSEAYRGVFSEVEIRSIVPYPKRILFTSSIPSEGKSLTASNMAAVFAAHGKKTLLVDCDFR
RPTLRRYFGTQSGVGLLPWLRENGSNAAAQVETQKMGIVTIAPGLDLLPAGDAIKNPTEVIDQLAHCDLFNKLSKIYDLV
IIDTPPAAVFPDALLLSRFCTEMIYVCRFKTVRKAVIRKALEKFQESGITILGVVLNCMPHASVMNYGYDGYGAYKADYY
KSYQGEKAESK
>gnl|bykdb|A0A290QE54 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=717 residues).
MSDSPLNPSNASQSGDQLVERRTIRDYLIILRERLWIALPLALLVAVGFGYWKARAVPMYQARATMQIEKPEKIVTSQEI
VDISINSDIELNTYLQVLGSAKLRGKVIQSLTPAEVKMLQQPFLATLEPGQPPPSIHEVVGSIGVQAIKNSFLISITATH
RSGEGAALIANRYVDQFMQDLLMNVGGKNEYAVQSLRTRAEQLRKEVEVADQRLQTYMKEQRLVSLDSSVNIVSDRLKTV
NAALSSARLDRLQLEELNNQIASFKKDARNLLEIAAISNHGTIPAVSSQLSELTRQQSVLAQRYFERHPKMIELEKSIKA
AREQLTRATDLAIADLHASLEKSRANEKSLEQEYALNEKEQIRLRDLSIDFKSLENQAAVAKGNYTQILDRLSQATTSSN
LERISVRPLDPATPAGAPYTPDIRSIAKTSIGLFVLVFVGVAIGLSFIDDRIKSSWDVEHFIGVHLLGIVPDLSGLKDDD
KYSLVLKNREAPGVESFLSVYSSAKIHSKLDYPKSILVTSTIPGEGKTLVSSNLAASFARHGKRTLLIDCDLRRPMVHRH
FNQPNDNGLITWFEHGASLDGDLTENQHLGITRLSENFSLLCSGGRSKTPTEILENPAFGQLLARLKKHFDLIIVDSPPM
GAVTDSLLIAERTDEVVYVCRFNKAYRKHIKLYIRALHNGKNDILGIVLNGLSTRRIEYYSNYRYYRSYKKYYGTQT
>gnl|bykdb|A0A2A2PVG8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiae bacterium Tous-C2TDCM] (length=658 residues).
MSRSYAPDSDANETGQSRGLQDYLRWFLRRFWIFLIAVVGGYFLGLYLYSVTPPTYQSSATIEILRVKRDAADIAEEEKI
RMTGAAEMLSASERIRLPQIYVEAAKGQLFANRENIAPAKKRFPWTKQMRFAGEDLSPEMLGAMLKGWVTVRWRTDTTLL
DLYATHTDPAIARDSLAAVLSAYEQLSESRVEGSSEYVLEYILDSSAEIKERLLDLESTLQLYQRCLELSKEIDEAERQV
AEMEKRYLPKWPALVEAKELLKILQDRFVQEFNQVMNLSEEERKYWETSLASLQGAPMEALTNAKRQVVSTRSNVLEREL
EAEKAVYDNLILQLKEGNVTRGFASRQFEVVQPPTMPAAPVAPIKTRMLVQFAGGGAALGIAIIMLLGFLDPTLRTVAEV
EQFCGIPVVAGLPAFKKRESRAESLELARDAQSKPAESIRTLRTGLTFLGTAEERCTFLIASSVPGEGKSWVASNLAHSF
ALQGDRTLLIDADMRRPVQGEVFGYGREPKGLADVLSLGTPLKEVILRSEVSEDLFLIPAGSWSANPAELLSGKSLRPLL
EKLSEYFDRIVIDSAPLVPVSDSIPIAKLVQSVVLVVRMGSTPKGAIKRAIRVLSDNGSHPVGIVANGLPQTRTAGAHGY
YYSYSSGGSYSGYSSNEK
>gnl|bykdb|A0A2A2R174 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Pedosphaera sp. Tous-C6FEB] (length=712 residues).
MDQYSQTQVGDTSSDHGMSLNRELWQVLVEKAWLIACIMAAAAAIGVWVGVRSPVVYQSKAVIELDFGEKKVLAIDDFEK
RDKGGGVDFLNTIANNVRSSAIIKRVVVGQSLTNHPYFTGGSNAPSEQMVVSSVSGAVDARLRRMTRLIDVTVELGDRML
AQTVAQSVVDEYIKERNEVRAGVGTNTSQFLMAEETRIKEKLLLAERAAEQYLRTNSSSLIQSQNIVTEEFKALNERRAV
ATDERRDVERDFEMTRRVGVKVAELLTLSTVSRVPEVVALKEKLQAQEAVLVNHQLRYKEKHPEMIKARAELESIRQQFE
AEVLKAPLRLGLQLQAAIEKEKGLEAAFKEQEKKLSDLNARRSGYEHLQADVTLHRSLHDAVIKRLRELDIVSGDKSKSE
VRVIEPANLPLTPIRPNKKMLLLYALAAGTALSVGVIWLLVQLDTTIKSVDHAERILGLPVLGAVPKNKLIRDGKGRLFI
SDDPQSLCAEAFRSMRASLGLLGREEDRKVVFFTSAVPSEGKSFCCVNYAVAYAQQGKRTLIIDFDLRKPTLAESFGIKE
DHFGVSDVLLNKAQLEQAVQTTRFDNLFLLTAGTTVPNPAELLSGQWTSKLIKEASAKFDHVVLDNAPINAVSDALMIVK
EAQTVCLVANARKTSYRAVLRALEMLRRAGAKPSGVVLNFLPQSAGSGYYYYYSGNKYYGQKGVYGATSSKG
>gnl|bykdb|A0A2A2R3V9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium Tous-C9LFEB] (length=713 residues).
MSSITPPPTLSSWSAAFFTKLHRYRALVKRRWYVPLLTLSVGLCIQAYRFAQIQPTYISSGKLIVSPRMFLPENAVVSDE
SVNFIGTQLELMQSAEVRSRARARVQALKPNLVPIPVALSAYQQPRTSIFTLQASGSEPNYTQAFLDAVMEEYISRRKET
RSEKSQSALLTIKEQVDKSEKEINQVDEEMLSFQKENNVIFMEEQGNKNATYLINLSKQLDDLNTEFQLLSKLTLDQNIE
RRSTNTSKPQTTTKNPATTNTAEKRTPDSEEIKAAAGDLLSPESEYRNSNQQIQLLLLQRDELSQYLKPKHPKIIALNAE
IQRQQTLLDMFKKQSIEQLNNRREGLRLQIQNLQELIKSEEVKALDVNRRMADYQRMKSKRQRLQAFYERLVSSVQSVDL
SQNIDQEMISIMEHPGLAQPVHVGMSGMLLNGFLLGLLAGVGILFLLDRIDDRINSFTELRDHFEEPVLGQIPMDPTLAR
KKGGPSLLVQDDRRHVYAESFRNVRSSLLFMAIDGTRPKTLLITSAIPNEGKSTFASNLAITMAFAGSRVLLVDADLRRG
RIHDAFSVSNQRGLSDVLSNQMNWRDAIQESAAYHFHIIPRGPTPPNPGELFLSSLVPSIFQEMRDEYDYVVVDSAPILA
TDDTASLAPKLDGTIFLMRTSYTSARLSRNAMDLLYQRQVNILGLVMNFVDTNLPEYYYYQYKEYYNRGAKAS
>gnl|bykdb|A0A2A2RPW6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Pedosphaera sp. Tous-C6FEB] (length=711 residues).
MQTTEDVTQQSPIGGLSSVALRDFWQALLDKAWLVVCIMLAAAALGVWHGARSPVVYQSKAVLYFDSGEVNVINIQEVEK
REKAGIDLLNSIANNLKSSVILSRVVKANKLTNHVYFTQGTNAISEERLTRQLAYVVDARLRRFTRLIDVSVELGNAKLA
QVIGQSVMEEFLKQNAEDRVGAGTNAGHALLASEAAIKQRLLKAEHAVAEYRRTKNISLQDTSDIQTADFKAMAEKLNEA
KDEVRLLELEWGMSQKVGNSVDELLKLPMISRSPEVAALKEKLQSHEAALSNLQLRYKDKHPTMIQARNELSTLKAQFEV
EIRRAPERLKLMREGAMAKEKKLEQELREQEKKLGQLSLLRIEYDRLQREAASERKLYDTVINRLREIDLTGNIEKKSEF
RIIEPASLPSIPIRPNKKMILLYALMVGMAASVGLIWLLVQVDSSIKSVDHAERVFGLPVLGAIPKNKLITDGKGRLFIT
DDPQSLCAEAFRTLRAALSLLGRDEDRKVVLFTSAVPSEGKSFTGANYAVAHAQQGKKTLIIDLDLRKPSLSETFGVSSN
QIGATDVMLGREPFEKGVQTTRFENLFLMTAGKMVPNPAELLAGPWAKQLIEEASKRYDKVVLDNAPVNAVSDTLLICKE
AQTICLVMHSRRTPVRVVSRALEMLRRAGGKPSGVVLNFLPGSAGAGYYYYYSGNKYYGSKGVYGASSSKG
>gnl|bykdb|A0A2A2RS01 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium Tous-C2FEB] (length=760 residues).
MAEKTQKPEDDQDDSAARGRGYGSYGNYGNYGGNYGGNYGGGYGAGYGQGGYGRYGVKEGGNPLYAYIAMLRERFWWLIL
AVLVGVTIALVLTYQTMPEYRAVGKLRVFRMAPDVTANNTAANNNFNITTNDDFYTAVESMRSTGIIESVSRQLTIDEKK
RVIEPYQQGNIFSGPLSEQEVFGRQRAINPLKSTFVVTVEFTHPNRDLARQVAGIFCKAIQKNSEDERLTITNPLVEKLR
SEIDLIEERLRKLSDKRSDLIKTQKLLSIAKDTTTLNTERGVLVRNREDARKQIDELEIIWKLILEYKTAGKDAYDIAQV
RTDERVAALGPKVTELRVLVSTMEKKYTDEHPTLIQTRAQLDQTQKELTQAVANSVNRIQASVQNARSSYDAIVANLERK
DDEIYRLQAANNELERVDKEIRGQEEFLARQKQNYEEQKLRSSTSGTSTSIKIQEMPSVADRPVNKNYYMNALTGMGLGL
LVGFGLIVLMGSFDDRVKSAKDVEMGLGLPLLGTVPKVTEAVGPDRALLARQDKDKVATEAVRAIYSAMKVSPATANSRV
FLVTSTRPGEGKTFVVTNLALSFAQHAERVLVIDADLRLPNVGPSLGFSGDGGVSRWFNGEMTLDEAIVRDVAPGLDVLP
VGMSCRNPTQVINNPKFLAMLDEMKTRYDRIFIDSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGSCLGRLAETGV
PILGAVLNRMSIRMASVYTDSYDPANKKYYIDSEGSDSSG
>gnl|bykdb|A0A2A2Y1A7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium AMD-G3] (length=760 residues).
MAEKTQKPEDDQDDSAARGRGYGSYGNYGNYGGNYGGNYGGGYGAGYGQGGYGRYGVKEGGNPLYAYIAMLRERFWWLIL
AVLVGVTIALVLTYQTMPEYRAVGKLRVFRMAPDVTANNTAANNNFNITTNDDFYTAVESMRSTGIIESVSRQLTIDEKK
RVIEPYQQGNIFSGPLSEQEVFGRQRAINPLKSTFVVTVEFTHPNRDLARQVAGIFCKAIQKNSEDERLTITNPLVEKLR
SEIDLIEERLRKLSDKRSDLIKTQKLLSIAKDTTTLNTERGVLVRNREDARKQIDELEIIWKLILEYKTAGKDAYDIAQV
RTDERVAALGPKVTELRVLVSTMEKKYTDEHPTLIQTRAQLDQTQKELTQAVANSVNRIQASVQNARSSYDAIVANLERK
DDEIYRLQAANNELERVDKEIRGQEEFLARQKQNYEEQKLRSSTSGTSTSIKIQEMPSVADRPVNKNYYMNALTGMGLGL
LVGFGLIVLMGSFDDRVKSAKDVEMGLGLPLLGTVPKVTEAVGPDRALLARQDKDKVATEAVRAIYSAMKVSPATANSRV
FLVTSTRPGEGKTFVVTNLALSFAQHAERVLVIDADLRLPNVGPSLGFSGDGGVSRWFNGEMTLDEAIVRDVAPGLDVLP
VGMSCRNPTQVINNPKFLAMLDEMKTRYDRIFIDSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGSCLGRLAETGV
PILGAVLNRMSIRMASVYTDSYDPANKKYYIDSEGSDSSG
>gnl|bykdb|A0A2A2YG59 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium AMD-G1] (length=759 residues).
MATPEPSSDNRPPEPARGGNRGYGSYGSYGNYGAGNGGYGYGNYGAYNRGGAGEGNPIHNYLLMLRERYWWVLLSTLVFL
TLSLLNTYNTVPEYRATGRLRVFRLAPTINGGSSAADDNFKIVSNDDFFTAVEAMRSANIIEGVSKRLTADERKLVLLPY
QGGNIFSGPLTEQEVFARQRGINPQRQTLVINVDFTHPNRDLARQVARHFCDAIKKYSEDDRLMVTNPLIEKARIEIETL
EDKVRRLYEQKNDLIKNQKLLSIAKDTNTLTTERSVLVKDREETRKQIDENEILVSVIASYEKEGRPLGDIPQIRADSDV
AATQTAISASKIRVSQMIETYTDQHPKLLAEREALKQLDNQLKEAVSQAIKSRRSSLENAKARLEAILRNLLAKEEEFTK
LQAANVELERVDKDIKASEEFLGRMKLSYEEAKLRSSTSGTSTSISILDAPSVSDKPINKNYYFNALVGVGSGLLFGVVL
IVVIGTLDSRIKSAKDVEDSLGLPLIGTVPRVANVSGPDRALLARQDKDRIATEAVRSIYSALKVNPAVSKARVFLVTST
RPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVGPSLGFTGDGGLSKWFNGEMSIDEAIVHDVSPGLDVLPVGLSCK
NPTQVINNPKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLARLREAQAPLLGVV
LNAMSLRMASAYTDTYDSSYRKYYVDEPRGQSGAGSEKS
>gnl|bykdb|A0A2A5VZA5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Puniceicoccaceae bacterium MED-G30] (length=758 residues).
MKNDYIKGGGDPNSGGYGYGYGYSGGSGYSYGNYGYGGYGGGGEQAPQRSIKDYILIFRERIWWLIVSFFIIFSGSLLYT
FNKTKVYTSVAVVRLLRDDPSAMGVSVELAQNQIVGAEDLNTQISLLQSGKIIQGVNRRMSDEQRKRFLLPYEGAFSFSG
PLTPTEILGKYRKIMPQRMSLMVNVAYTHPDAQIAADVANLFAQEFINYNLSENIDASMVAVEGLRIRADQQKERVEEIE
LKLAEYRERHNAVSLDSQENIAREQLVTLNQIKLESKNNYDQLDTKWNLIETYKREERKLWQLTFVAEQSRVSRLLESIS
ATRIEISSYSKRYREKHPIMIQLLQTLQESEIELQEAVTNSVDKLYASYIEAKSNFELSSKRLAEKESELIALSKTRVEY
NTLLRDLDVQQSFFQALNSRMTQEKAQVSLKEANARVVDDAFPPLRHSSPNITVNLLVGVFGGLAVGGGLVFIVAFLDDR
VKSAFDIEGTIGLPLLGVIPRIKKLDSSTKAQAVAANVDRHVTETFRSIHSSLKLNDESKNAKIILATSTVPSEGKSFVS
SNMALTFANHGERTLLLDADLRLPNIASSLQLPNEFGLLDHIEQGSRLDDMIVSEVYPNLDVLPSGGKSKNPTQVLVSAQ
FEAMLADLRDRYDRIVVDSPPLAAVSDALNLLPFVDGIVYVIKFNTVKRKTAVANVRRLWESNTPVFGAILNNITTSLSS
YYYSQYTDKAYQDYYIGQEDEMEDELAASTEPEEKVES
>gnl|bykdb|A0A2D5W0Q9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Pedosphaera sp] (length=274 residues).
PNIKSQSLVERDLQAHLHPQSNAAEGFRTVRAAVSLVHKSDKFKVLSMTSTIPSEGKSLVASNLAIVTAQTGVKTLLIDA
DLRRPSMHKAFQMQSPIGLSAYLTGQITDPSEITQTTEVPNLDLICCGAVPNNPSELVGSKRMGELLDSLRDRYDRIFVD
CPPVSAVSDPLMVGARTDGMVFVSKFNKIRREHARKTVQRIQDAGIYILGTVINDIDFEGKDSYYYSYYYYQNRYYASYY
SNEKKLGSKKGEGAKDGELVQGGKAGKDDEPSKA
>gnl|bykdb|A0A2D5Y6N6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=764 residues).
MDDNFNKMTGDGGASPTGSKIKGIGDFILILRDRWLIALTLSLPXALAYIYVKSQGIELFRSSASFRLIPPPAILNLQKV
DRDQHVQGLVAXHLDGLNSQDLRLNVTQKIKDTPELKSELLSPYLKDGISIDVGATISYSISVSPPSEGRPRFTINSTAR
SGRGAQIIADVVQSEYEKLHKSKKSLQVENVKNVLQLLLDKSLQEEERISQEQSSFKKKYDLPFLEDEKQDTSARKSQYQ
SEITSSKLEQIRINSLLRQILQIQVRIGSQSESTSSQDIDDDIAVIKEFFEIDAIESYGSIPSLRQNLYDLESKRRDYQE
TGSGYLERHPKMIENARQVQLVKQALNKEVKSAIEDLRDKHIQLTAQEKEFASAMAKVQEESRTLSEIEEKLKNLDRQLA
VVTRTTDQIHNRLNDVRIEQALPSEQEEPLNKEQFAYLPGAPFTPDKNKIKRDGTMLGLAIFVIIPFLLEFIDNRVKSPW
DVEVFIGRDLIAGIPKISEVEENQRPLIVGNDLDDGLTESFRSMFSRIQMNSLNDYPKTILVTSAIPSEGKSLISANLAY
SCANHGKKTILIDFDLRRPGIHKFCNITNEKGLLSLINSEKTDLKELQELAQSTVTQIHPNLLVLPSGGKTRAATELLES
NSFDRIHKILRTIADVIIIDSPPIGLFPDSLAMARKVEEVLFVTRYGKVSRKIAKSLLENLDETGAKILGVVLNDLPQKK
APGYYYSGYYGYGYFRYKYYNKYYGRERDDEPSSPTVQGKESVS
>gnl|bykdb|A0A2D6VHX5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=753 residues).
MDLEENSNYGDYSPKSKKNKTVSEFLLILRDRWLLAVTLALPFSLAYVYKELQVPEMYQSSSSFVLIPPPKILNLQKVDR
DQQVNGLISKHLDGLNSQELRMNVIARINENSDYKTELLAPYLSDGTPMKIQNIVTYNVSVSSPSEGRPRFKINSQSRTG
KGAMIIADLVQKEYDKLNSIKKTEQVQTAKGILELLLDKSLMEEDRILKEISDIKESNDIPFIEDAKKINSSKKSQFQAK
ITASKLDQIQINSILRQILDIRKRISSNKESSIDSTNTGVDVESNIAQIKQYFEIDVIEGFGSIPSLRQELLEHELQRKT
YVETGTGYGPNHPKMIENARQVQEVQELLRKEVTLAIEDLRDRHIQLDAQEREFMGAMDKVQTESRRLGHIEEAISKAER
TLAVVRSSTDIIRKRLDDVRIEAALPSEQDDPLQKDQLAFTPXSPYSPDYNKIKQQGVLIFVGIFLVIPIALEVIDNRIK
SPWDIETFVGEDLLTGIQKISEIDELRRPKIVGDDLDDSLTESFRSMYGKIQMNSHVTGSKSILVTSAIPSEGKSLISAN
FAHTCANHGSKTILIDFDLRRPGLHNFCDESNDEGVMTILNTPNATEEEVTDKLKKVLCSIHPNLFLLPSGGKTRAATEI
IEKKEFELLLTCLKKLADVVIFDSPPAGLFPDSIALARKTDEVLFVTRYGKVSRQVVKRLIGDLKATGANILGVILNDLP
SKKATGYYYSGYYGYGYYRYKYYSKYYSPTEDT
>gnl|bykdb|A0A2D7B7R6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Pedosphaera sp] (length=734 residues).
METGNTNSPQDILRSAKSHYAIVLIIIVACTFTAYMQTRKMTAHYRSTALLVVDTQQFVESDADASNDVRDLDILTTLVG
RISTTPVLSHVIEISPELQEHYKVDLNDPRSITSASKKLGANITAKLRGDSLFIDLTANSENRDLAYWSAKYVSTGYTNF
LKVNSRSKAMGGLIQLERGRELSQKDLEDAQKALIRFQTKNRITNLKERKEQLETKNNSDRLVLDNLKLELSRIQNDLED
LESVGYVDAASEKARPDNLTNEQLEIVSLIPSVAKNEDFKSINGLYKAAKTTVRNLEVDLKSKHPLMIDALRNVNNTRRV
LLETISDVPKGLYAQIKYQQEFIEELTQSIENQTSKLFEWEQLYMQQAALEQDLEIGTKLIDNIKDQIQSIEFTAESEGT
TIELAEKATEPSTIEPNKTQRIILGVLLGLGLAYGYLYLMNMMDQSIKSVEQAEKILQLPVLAAVPVSEINGKPTDSRLV
MIESPNSTCSEAFRSLRVNIESMTRKKSHKVVLFTSSIPSEGKTFTSINYASSLAQQGHRTLLVDMDLRKPAVGPEFKLG
EEYVGVSDLLQSEDKLGQFPDLAIYEATEKLFVLHGGSHISNPSEHISGSAIEELILKARQNFDRIVIDSAPLGPIGDTL
SVARLADMLCLVVRSGKTTSKVVLRIIDYLHRHGHTPSGIVLNFLRNNNNKGSYYYYYSSDKDKTYSKSGYQKKQVTNSP
MEVGASAEDEPVKS
>gnl|bykdb|A0A2D7F4D9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Puniceicoccaceae bacterium] (length=792 residues).
MKNDYTGDQSNMNSNHYGGYSNNYGNPQYYNHGSYRYGGNSGSGSYGYGSYGNVSEEQGPQRTFKDYIFLIRERIWYLII
VFFIIFLGSILYTFNKTKLYTAYATIELLRDDPTVMNSASNLEQNEIRSSEDLNTHISRLESVSIIQGVEKRFQEDELAQ
FMAPYKGTFSFSGPLTAFEILSINRKIIPRRMSLMVNIAYTHPNPIMAAKIANLFGDEYINTMLSQNIDASMKAVEDLRK
RAEQKKNRVEELELKLAEYRELKKAVSLDKQENIAAEQLASLNEIKTMAKMNLDQAEIRWNLTQDYQKQGKELWELPFIS
EQIRVATLIEQISAIRIAISTKSKRYREKHPEMRSLLQQLQESQSELEYAVQNAVDNISGYFAESRDNFKQASKRLLEKE
REMIELSKTRVEFNSLIRDLEVEQMTYQKLTALMAEEKIQVNIKNANARIIDKAFPPREDRPSSPNVFLNLAGGFFGGMI
FGLGLVFAVALLDDKVKSVYDIEASLGLPILGIIPKVKKLDSVSKSHIVTSTTNRHVTENFRSMLSYLKINDQTKNSNVF
LLTSTVPSEGKSFISSNLALSFASNGEKVLLLDGDLRLPNVAKSLQLENESGVLDYIQGEGTFDSYIAKEVYPNLDILAS
GGKAKNPTAILNDSKFESMLLQLRDRYDKIIIDSPPLAAVSDSLNIVPLVDAVIYVIKYDSVKKSLANSCIRRLWESKTP
LLGAVLNNVSLGLSHYYYSQYSANKKYSAYYMQESYLGNMDESEAEESNQAIVADTFTETKTDSDSEDKLDS
>gnl|bykdb|A0A2D7V631 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=758 residues).
MDDDIDSISVNAGGKPKSRIKGLSDFVLIIRDRWLLSLTVALPVALGFVYNQLQGPEYYASSSSFRLIPPPAILNLQKVE
RDQHVQGLVAKHLDGLNSQELRVNVIQKIKDNPEFKSTLLAPYLKEGISMDVGATVTYSVGVSPPTEGRPRFTINSNSRS
GKGAMIVADVVQSEYEKLHKSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSEYKKANQLPFLEDEKKDTADRKSQYQA
EITRCKLEQIRINSLLRQILQIQMRIGAQTSSLKSDDVEGDIAVIKEFFELDAIETYGSIPSLRKTLYDLETTRKNYQET
GTGYLERHPKMMENARQVSEIKTTLNLEVKSAIEDLRDKHIQLNAQEKEFATAMQKVQEDSRKLSEIEETLTNFDRQLAV
VRKSTDQIQSRLNDVRIEQALPSEQEEPLHKEQFAYQPFAPYTPDKNKIRKSGFIIFFAVFFALPILLEFVDNRVKSPWD
VEVFVGHDLIGGIPKISEVEERQRPLIVGNDLDDGLTESFRSMYSRIQMNSNSDYPKVLLVTSAIPSEGKSLISANLAYS
CANHGRKTILIDFDLRRPGLHNFCNITNEKGIVSLVNEVVKGSSDIDEQIKSCLHEIHPNLHVLPSGGKTRAATEMLERS
EFDYVMNKLRQIAEVIIVDSPPIGLFPDSLAIARKVEEVLFVTRYGKVSRKVAKSLLENIEETGANVLGVVLNDLPQKKT
PGYYYSGYYGYGYFRYKYYNKYYGKDKDEKPPVEKLTT
>gnl|bykdb|A0A2D7WMI4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=743 residues).
MDENEIGSLSQNPPNQKVKGISDFLLILRDRWMLSLTLALPIALGFTYKSLQVPEFYASSSSFRLIPPPAIINLQKVDRE
QQLQPLVSKHLDGLNSQELRAQVVTKIENSPELKTEILAPYIQEGAVTSVAAAISYSVSVSGEGRPVITISSNARSAQAA
MIIAREVQTEYEILHRSRSNLKVESAKQTLEGLLQKEIQKEENIKRQITALKIKRSVPNLEDIKRDNATRKSQYQSEITR
CNIEQLRLDSTLSQIRSILKRINSNKESSNSIEERFELFSEIFKIDEIENFANIPALRSSLFELYKQRRDYQEVGTGYLS
KHPKMLSNARQIQDTYGRINKQVKDAIFDMDNRKLQLQALANDFTVAMTTVQDEANFLSKIDDNISSMERELEIVQTSSG
QMQKRLNDVTIEQAFPQDQDDPLQKEQFAFVPGGPYSPDKNGIYKKSFGIFVGIFFVVPFLLEFIDNRIKSPWDIEVFLG
RELISGIPKISNIIENERPLIVGNDLDDGLGESFRSMFSKIQMYSKTDYPKIILVTSAIPSEGKSLISANLAYTCANHGK
NTILIDFDLRRPGLHKFAGLDNESGIITLVNEMSQNPNFIDSGLKKHLKNIHPNLNMLTSGGKTRSVTELIERKEFGILL
DKLKAESDVIVVDSPPIGLFPDALAFSKIADDIIFVTRYGKVARRVAKNLLYSIEESGTNILGVVLNDLPQKRSTGYYYS
GYYGYGYYRYKYYNKYYGKNQDS
>gnl|bykdb|A0A2D8I214 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=750 residues).
MEEEIENLNSQGSVRSKSKTKSIAEILLVIRDRWLLALSLALPISLGYVYLKFQDTEFFQSSSSFRLIPPPAVLNLQKVD
RDTQVQGLVAKHREGLNSQELKASVIQKISDNPESKSIMLAPFLREGIPVGVESTISYSISVSPPSEGRPRFVISSTSRS
AKGAMLVADLVQSEYEKLHKSKKNQQVESVRNLLEKLLAQSIEKESQLADEMSAYKKNLGLPFIEDEKRDTADRKSQYSA
EVTTSKLEQIKIDSLLRQVLQIQARIGSRNSSSRSKDIDNDIALIKDFFEIDAIESFGNVPSLRKTLFDLEKTRMRYQEG
SPGYLERHPKMLENARQVNEVKNSLIKEVTSAIEDLKDKRVQLTAQEKEFQQAMEKVQQDSMKLSEIEEWLINKERELTV
VRTSTDQIQKRLNEVRIEQALPSEQEEPLHKEQYAFLPGGPYTPDKAKIKRTGIYIFLGLFILIPVSLELVDNRVKSPFD
VEVFIGKDLIGGIPKISDVEEAHRPLIVGNDLDDGLTESFRSMFSRIQMNSQTEYPKTILITSAIPSEGKSLISANLAYS
CANHGRRTVLVDFDLRRPGLHKFCGIENKTGLVSLVNVASSKENLKNSINDSVQEIHPNLYILPSGGKTRAATEMLEQKE
FDIVHNELKEMFDVIIVDSPPIGLFPDSLAIARKVDDVLFVTRYGKVSRKIAKNLVENLEETGVNVLGVVLNDLPQKKAP
GYYYSGYYGYGYFRYKYYNKYYGKEKKSEA
>gnl|bykdb|A0A2D8VCK3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=758 residues).
MEEDFDNFSSSPVQKGKSKIKGLSDFLLIVRDRWLLAIALSLPCALLWVFYKQQEPDKFQSSCSFSLTPPPAILNLQSVE
RESHLEGLISRHTEGLNSEKLRINVAHQLDNNPQYKSVLLGPFLKQGVRVGIASAYSYRITQAGSKSRPRFIITSDARSA
LGAKYVADVVQKEYEKLHKSTKNEKVEFVKQTLEDLLDTSLGKEKKIAADMANYKKEHNLPFLEDEKRDTGDRKSQFSSE
VTKSRLEQIRINSLLRQILAIKTRIGSNSNSVSSKDIKDDIAVIKEFFEIDAIEQFGNIPALRQTLYDLEKTRRDYEETG
SGYLERHPKMLENARSVQQVKSALRQSVTSAIEDLRDKHIQLSAQEKEFADEMEKVQKQSEQLSEIEETLKNFERELAVV
QRSTDSIHSRLNDVNIEQALPSEQDEPLRVDSVAYEPGGPYAPDKNRIREEGMMIFAVLFILIPVCLEFIDNRVKSPWDI
EVFVGNDLIGGIPKISEVEERERPLIVGNDLDDGLTEAFRSMYSRIQMNSQTDYPKLILVTSAIPSEGKSLISANLAYSC
ANHGRKTILVDFDLRRPGLHKFCNLENSKGLLSLVNDVGKPGQDVQNCISESLTEVHPNLFLLPSGGKTRAATEMLEQND
FSTVIDLLRRNAEVIIIDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIESINDTGANLLGVVLNDLPQKKTP
GYYYSGYYGYGYFRYKYYNKYYGKSDAEEKRKKKQAVS
>gnl|bykdb|A0A2E0NH28 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Coraliomargarita sp] (length=765 residues).
MKNDYVRGGPDPNTSGRYGYSSGNYGYNGSNYGYGSYGSNSSGYGTIAQRSISDYFLMLRERVWYLVVAFFIIFSGSILY
TFNKTKVYTAYVSVQLLRDDPSAMRDETEMEPNQILSAEDLNTQISVLESLSIIQAVERRLQDEERARFMAPYADAFSLT
GPLTPVEMLAKNRKIIPRRMSLMVNVGFTHPDPIIAARVANLFADEFIAYNLTKSVDASMDAVEDLRIRADQQRQRVEEL
ELKLAEYREEHNAVSLDQQENIANEQLMTLNAIKSGNKNQFDAQETQWNLIESYRRDGRDLWELSFIADQSRVAFMLQEV
SKTKIEISSLGKRYRSKHPVMIQLLQRLQESEIELTEAVTNSTDKIYAAYIEAKRNFEVSSQRLAEKENELIQLSKTRVD
YNTLYREFEVQQGFLTAIVSRMTMQKAQINLKNPNARIVDEALPPLRHSSPNLFLNIALGAFGGVVXGLGLVFGIAFLDD
RVKSAFDIEGTIGLPLIGIIPQIKKLDSTTKAQAVASNVDRHVTETFRSIHSAIRLNEESKNAKVFLTTSTVPSEGKSFV
SSNLALTFANNGDKTLLLDGDLRLPNIARSLQVSNDNGLIDYIDHDVDINAVIVNEVYPHLDVLPAGGKSKNPTQILNSA
KYSSLLGSLREKYDRIVIDSPPLAAVSDALNILPHVDGVIYVIKFNTVKRKTAVMNVRRLWESNTPVFGSVLNNVSTALS
SYYYSHYSDKSYQDYYINNEDDFEDQLVESTASGDEDTSEIARET
>gnl|bykdb|A0A2E0R252 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=660 residues).
MNEVDPPQNGYGNEAPASNGKGIKDYVRWFLRRFWIFLITCLGGYFLGLYVASLTPVTYQSQATIEIERVKKEDADVDEE
ERIRMGGASEMFSVTEKLRLPNLYTNIAASPKFAEREDVASEKFHMPWEDVPSVSGADMSPETLGGMMRGWVTVRWRKDT
TLIDLYASHSDPEIARDTLEGLIEEYDRSVESKVAGSSEFALDYILESSDKVKEKMLNLERALRLYKRCLELSDEIRGSE
TAIAQMEKRYLPKWPALVEAKELGAILKKNFSKELDQVIRLSDEEKAFWEQHSESFSSMDADTRIDSQIQIASTRASVLE
RELEAEQQIYDNLITKLKEGNVSKGFDSKQFDVVQPPSLPANPTGPNKKKITMKYLFGGAALGVGIILLLGFLDPTVRTV
ADLEVLTGTPVIGAMPASKNTERKGSLALDAEDEQSQSAEAIRTLRAGLTFLGTSEERRTFLITSAVPGEGKSWVASNLA
LSFASQGDRTLLIDGDLRKPVQSQVFDYDKEHPGLSDHLSLNRPLKEVVMKTRESENLFIMPAGSRSANPSELLAGKGLK
GAIGALEEYFDRIIIDSAPLVPVSDSLPLAKLAESVVLVCRVGKTPRGAIKRAIRVLEANHSAPVGVVANGLPRTRTKGA
YGYYYSYYGGGNYANYSDAK
>gnl|bykdb|A0A2E0R421 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=705 residues).
MIDHHQQPLEENLHSNPQARGLQDYVRWFIHRFWILPITIVSGILIGHYVYTHTPHTYQSSATIEVLRIKKDDADVDEDE
VLRMNGVAEMMSASEKLRMPALYTQVAKSYLFENRDDVFPDRFHLPWEKRQNPTREDISDVSLGNMMRGWVSVRWRPDTK
LLDIHVTHTNPEVARDVLVALLSEYERMTESKVADSSEYALDYILENTNRIRKGILDLERAIELYNNCQDLITEIKLVES
RIAGMEKRYLPKWPALVESKEHSKILKQRFSAELERVLRLSEEERQFWEDAGTSIADVEGEELATDQMQIVATRSRSLGR
ELESEQDIYNNLIAKLKEGNVTKNFAGKQFDIVQPASLPGGPIGPNKKSIMSKYTMGGVAVGVALILLMGFLDLTIRTVS
ELEGMTGKPVLGAIPDEKNPGEGVLVLNCKDTPLQAEAIRTLRAGLTFLGTPESKRTFLITSSVPNEGKSWVASNLALAF
AKQNERTLLIDGDLRRPRIHKIFGFDRDEAGLSDHLSLRTPLNKVVKPTDKSGKLYVLLAGSPSASPSELLASKALPALV
DKLGKYFDRIIIDSAPIVSVSDTYPLAKIAQSVVLVCRMSMTSRSSIMRALRILKVNQSDPVGIVANGLPVAKTKTGHDY
YYSYPGSGSYGSGNNSDTEKIKTTRVRVPLFQNILNLGSKMKDHDFFSKKQKRPRRRNRRRPSRR
>gnl|bykdb|A0A2E0V4K6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiaceae bacterium] (length=720 residues).
MSARRLAGAGRELPDEDEVLEFPGRARGLPKVFWEMLGKWYFPVMGAILGLFASAYYLKKTPERFASTATLLVKQNLSGV
ISSEEVEDLDLRSDNVMNTIAAQVTRVGILEKVAQRPEFAGSEDLVRKPASYMPDWASAFFAREGARESNSEPDTGANLT
RVAAMLAQRCDATVRKRTRLLDVTVTHEDPELARTLADAVVDEYLKELAEEDKGSADRRSAGLLGQADVARESLQEANSA
LAVYNRALETHAALEVEEVKVADLARRYRGKHPKMIAASAKLAAAKGSFLEEFLVAARSPVDKSYWEGVSDQLGTIKDGG
EAEVAIARRLLLARTQVLDGETKSRMSVFNSILVAMEESKVNQIDDEVIADLHSRASTPETAVYPNRIRSYFAGGAGGAA
CGVGLILLLLRIDNRFRTVAQVEEETALPVLAAVPVLSAKRLSAAEKSNKERQGEGASRDEEHLWDSGIVFRPGLQSSLY
AESYRILRASVVLLGDEKERKVSLFFSALPGEGKTTTSINYALATASQGRKTLLLDMDLRKPRVHRQLGRRRSEQGKGMA
EILARQCPPEEAVCQDVGHGNLDAVFAGGKVRNPGELLKPGAIRELLQWAREHYDHVVIDTAPVLAVPDTRIILPQADNR
CLVIRANVVPKPAVFRAIDLLEEDGVKLAGVVMNGYRESRRLLGYNYSYGAYRTGRYGYRQYGYGGYGSYGAYGSDDEED
>gnl|bykdb|A0A2E1KV60 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Puniceicoccaceae bacterium] (length=803 residues).
MKNDYSDNNMGNDNSYGNYGNYAPGNQYNQYNSYRYGGGGNYGNYGNYGNYGYGSYGQNADEQGPQRTFKDYLFLIRERI
WYLIIVFFIIFLGSILYTFNKTKLYTAYSTIELLRDDPTVMLSSSGNLEQNEIRTAEDLNTHISKLESITVIQGVEKRLQ
EDEFAQFMAPYKGVFSFSGPLTAFEILAKNRKIIPRRMSLMVNISYTHPNPIVAAKIANLFGDEYINSMLSQNIDASMKA
VEDLRKRAEQKKNRVEELELKLAEYRELKNAISLDKQENIAAEELASLNQIKTAAKMELDQSETRWNLIQDYLRQNKDLW
ELPFISQQIRVASLTEQISNIRIAMSTMSKRYREKHPEMRSLLQQLQESQSELDYAVQNAVDNLNASFKEAKDNFAQASK
RLVEKERDMIELSKTRVEFNSLIRDLEVEQMTYQKLISLMAEEKIQVNIKNANARIIDKAFPPPEDQPSSPNVFLNLAGG
FFGGIFFGLGLVFAVALLDDKVKSVFDIEASIGLPMLGIIPKVKKLDSVSKSHIVASSSDRHVIENFRSMLSYLKISEHS
KNSNVFLITSTTPSEGKSFISSNLALSFSAHGEKVLLLDADLRLPNVAKSLQLENDSGVIDFINGDDSISNFIVKDVYPN
FDVLPSGGKSKNPTAVLSDEKYQSMMLELRDRYDKIIVDSPPLAAVSDALNVVPYIDAVLFVIKYDSVKKSLVNSCVRRL
WESKKPVLGAILNNVSSGLSSYYYSQYSSEKYSQYYLQDSYLDLNESNATKSLDSSTANDQSAGVDTAVAESDTNTDTDK
LDS
>gnl|bykdb|A0A2E4AY96 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=746 residues).
MDQEHPESFKNQGDTIKVRGVSDVLLILRDRWLISLCIALPIALTIAYKDLQVPEFFSSSSSFRLIPPPAIINLQKVDQQ
EQQFQLLVGKHRDGLNSQELRMQVITKIENSPELKREMLKPYVESGIPTSVGSTVSYSISLSEESRPRFTITSNARSAKS
AMIIAREVQSEYEILHRSNSSLKVESAIKTLERLLDREMKKEKDIQAKISQYKAEKEAPFLEDDKKDISAKKSQYQAEIT
RCRIERLRIESLKSQVLAVDNKIKSRKVESIEERYALFGEFFKIKEINQFGRIAFLREDLQKLYSTRKNYQEVGTGYLEK
HPKMLANARQIRDTNMQILSEIRNAISDLYERENQLLALEDKFSIAMNDVQIEAKDVSLIDDTLRNFERELQIVQTSSAQ
MQKRLNDVTIEQAFPQEQDNPLQKEQFASLPASAYSPDKAAIQKKAATVFLAIFILFPFLLEFIDNRIKSPWDIQVFLGR
DLISGIPKISNIDEQERPLIVGNDLDDGLAESFRSMFSKIQVNSLVDFPKVILVTSAIPSEGKSLISTNLAFTCANHGKK
TILIDFDLRRPGLHKFVGLENEGGLIPIINKSAEQPNYIKENLDSELHDIHPNLKMLTSGGKTRSVTELIEKNQFHELLG
KLKSSADIIVVDSPPVGLFPDAMALSKIVDDVIFVTRYGKVARRAAKGLLSNLEESGSNILGVVLNDLPSKKSTGYYYSG
YYGYGYGYYRYKYYNKYYGGSKSNTG
>gnl|bykdb|A0A2E4ZYR7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=680 residues).
MQPVDRDKYSARIIGQHLEGLRSGELRNRIVRAINEDDHKKATLLAPYVKQGPPPPVASVVNYTVSLAGEGTPILRINSM
ARNGEGAAMVANLAQDEYERIHESRQGKKHDTAIAFLEEQMTRSRNAETEIDNKVREFKRRHNLAFIADEKKDVADRKSQ
YQSAITQAQVEKLKIQSTLRQIIAIQGRVERATNAVKDNEHARANAETDKIKEYFEISAIEGYGNVQTLRQKLLDLETIR
KEHEVKYLELHPKMSSNTRAIMELHRLLRLEVKTAIEDLTNRVSELASQEREFTKAMLAVQKESQKLDDIEVQILGMTRE
GLVHRTTYDQMLKRLNEVKVTRELPQDEDDPLRRGDVAMTPATPISPDKAAIRRTGILIFVACFILIPIGFEFIDNRIKS
PWDVEVFIGRDLIAGIPKISTIKEADRPLIVGNELDDSLMESFRSMFSRIQMNSHVEYPKSMLITSAIPSEGKSLLAANL
AYSCANHGRRTILIDFDLRRPGLHKFCGVSNDRGLLTLVNEINGEHDTEAERNALTEIYPNLYVLPSGGKTRAATEMLER
PDFDILLNNLKKLCDILIIDSPPVGLFPDSMAMARKVDEVLFVTRYGKVARKVVKNLLMRMDETGANTLGVVLNDLPEKK
TPGYYYAGYYGYGYFRYKYYNKYYGGRGEDEKAEKKAQAS
>gnl|bykdb|A0A2E5D7I3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseibacillus sp] (length=414 residues).
VELKEVQSNESEGLATARRLLLARTQVLDGETKSRMSVFNSILVALEESKVNSIDEEVIAELHSRAAPSDSAVFPNRLRV
QAVGGIGGVASGLGLVLLLLXLDNRFXTVSQVEXETGMPVLAAVPVLEAKKLEAAEXSESXSXAKTXEGEGAPREMVSLA
RDVVFRDGLHSSLYAESYRILRAAVMLLGDEKKRKISAFSXALPGEGKTTTSVNYALALASQGKKTLLMDMDLRKPKVHR
QFNLRRGDLETGMSEVLSNQCDASEAVTKTPGIERLDAIFAGGKAPNPGELLREEAISKLFAWAREHYDHIVIDSAPILP
VPDTRIIFPLVDNPCLVIRANVVPKPAVFRALDVMEEDGSRIVGVVLNGYRETRRLXGYNYSYGSYRYGKYGYSQYGYGG
YGSYGSYGSDDXED
>gnl|bykdb|A0A2E5EJ69 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=699 residues).
MDFPESHDLGQQTQVEKEFSLRDSVDVVLDHAWLIILIFAACFGGAYYYLKTATVIYESRATIIVEFAGPTVSYDQNSRN
DFRLMRFDILNTMAQTVGRREVIDRAAELIVDREQLSPDISQNDLRGQLGGVSSSLRKMTRFIDVSFRHRDRVFAMNANQ
AIVEAFVNWDIERKMGRGTNTIAIHTTAAEELKVKWLEAQEIAHQYVKSNSLAVGMTDMKRMELESIGKELTVSKNEKLK
LDTDWKMIQQYSNNVERLLTVQSILDDKQVSALRTQELEKRSEISQLEERYREKHPKMIAARKEVVDLGARLQEAILAAP
SKVHTTILTLSSQIDSQQGRLEAQEKKVAADQQKEIEYKHLKAQAESLQAMYQRVLGAKQESSVTEGIQNRTVEVYNPAS
LPGAPVSPRKSVIMMVAMIVGCGLSFMLVFIVQQLDKTVKSIDEAERLFGVPVVGAVPKNPEIKDDQGRLFVTKAPNSSC
AEAFRTLRASISLLGREEERRVILFTSAVPSEGKTFCSVNYAIANASQGKKTLIMDFDLRRPSVGDTFHIDRKTPGVTDL
LLANKTLDEVALKTDFENLTLIPAGSTVPNPSELIASDHVKKLIDDVVGKYDQVVIDNAPVTAVSDTLLILEYVQTICMV
TRAAKTSYRLIGRALELVRRSGKNVSGLVLNFVPEKRRAGYNYYYYTDKKYYGYGEDKR
>gnl|bykdb|A0A2E5K4P7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium] (length=765 residues).
MDSEPPEDSSNSSYRGYRYYGGYGYNYGGYDAEPQEHRSLKDYIIIFRERFWLFLFCFAIIITGVLLYTLKKPKEYKSVA
ELRMERFGNTPIDTGNEKNQDNIGSHEDFNTWANILKSPTITSMVETRLKASEVDYNNFMEPYQKMDKNGGRDEEDPIVA
GPILHEKRRIIPKRLSLVIQIEYIHPNPEIAATVVNHFAQSFREYQLDQSLKKGISDISKLGTEIQEKEKDVLVLEAKAV
NYKTQFTSLGLDSEENIFLRELTVLREHLIKKDDVRKAVESRWQQLLAYEAEGRSLLDLGFISNTTHVATLVARNSLKKE
ELGLLAARYRSKHPKMLQALQAQALVKKELDNAILMARNKAEAEHLLATVHYKEAQRDVAIKEQEYLALEKNREEYGGLT
RKLEQARKSLEHLRMLKFKEDVRTDTKNSSVNIYVDGVAPTKHFTPSLTLNLAFGTIGGAGFGLFMVFFTAFIDNRVKSP
FDIEQVIKLPLVGVIPQIRKLDSFKKARIIESAKDNHVKEAFRSIFSTLGVNDASKDAQVILNTSTIPGEGKSFVSTNLA
FTYAESGNRVLLLDCDLRLPNIAKSLQLELTTGLLDYVQGTATLEEVIVPGVFTNLDILPAGGRSRTPMTIFNNEYFPFL
MNEIRQYYDKIIIDSPPLAAVSDALNIVPFVDGILFVVKYNTVKRNTASLTVRKLAEAGKPIFGVILNNMASKSAEYYYS
EYYTGQYKKYYTSQGAPEVSLGETSNSHPKPARKMNLEQGSEAQA
>gnl|bykdb|A0A2E6NAH3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutales bacterium] (length=772 residues).
MKNDYIRGAPDPNSGGYGGSGYGYGGGNYGYGGSNYGYGGGNYGFGGGYGDGGAGPQRSFKDYLLMFRERIWYLIVSLFI
IFSGSILYTFNKTKVYTAASQVQLFRDDASALGAIGQGMEMEQNQILSAEDLNTQISVMESLSIIQGVEQRLQDELRLRF
MAPYEDTLSLSGPLTPLEILAKNRKIIPRRMSLMVNFTYSHPDPFLAAEVANLFAKEFIDYNLKLNIDGSMKAVEDLRIR
ADQQKNRVEELELKLAEYREQNNAVSLQSDENIAAVQLSHLNEIELTNKNIYDQFQTKWDQIETYRLEGRNLWELPFVAE
QSRVASLLQQVSSTRIEISSLGKRYREKHPAMIQLLQTLQEGELELSRAVQNSVDKIYAGYSESKSNYEVASLRLAEKEK
ELIELGKTKIEFNSLLRDLEVQQSFFQALNQRMTTEKAQVNLKNPNARIVDEAFPPREDQPSSPNVVLNLAAGFFGGIAT
GVGLIFAVAFLDDRVKSAFDIEGTIGLPMLGVIPRIKKLDTSTKAQAVASNVDRHVTETFRSIHSALKLSDHSKNAKVIL
TTSTVPGEGKSFVSSNLSLTFANHGEKTLLLDCDLRLPNVARSLQIENDLGMLDYVENGVSLDEVIVKEVYPNLDVLSTG
GKSKNPTQVLNSAQFEAMFSDLRNRYDRIVVDSPPLAAVSDALNLLPMVDGILYVIKFNTVKRKTAVINVRRLWESNTPV
YGAILNNITSVLSSYYYSNYSDKAYQDYYINQEEELEEELVGDIETELESKS
>gnl|bykdb|A0A2E6T1E0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=521 residues).
LTYKRENDIISLEESQNVTLKALIQAQTDFDMARSAEVTAVAAAEEAARVFHETKQYGTIPEVATDTEVRKIRGDLALAE
AELAELLKRYLDKHPKVIEKRGKIESLIEGLASSQKRIFDSIINKAELAKATALNLKGVLEIRKSEQQAMNQKSIQYFAL
EREAKQSETLYNLALQRLKETELQEKDIVQNMHVIDLATAQMSPIKPKKLLTLFLGIVGGLGAGFGLAFFVNFLDDSIKS
QDDVETYLNLPFLGYIPNIKTTSIIERDLQAHLHPQSNSAESFRTVRAAIALSQRAGDLHLMAVTSTVPSEGKSLVASNH
AIVMAQTGVKTLLVDFDLRRPSVHKAFQLQSPRGLSSYLLGKVDSIDAIVHQTEVPNLDVICCGAVPNNPSELSGSQRMR
DFVEEVRTKYQKIVFDCPPVSAVSDPLIIAAATDGIIFVNKFNKIRREHARKTVQRIQDAGINIVGVCINDLDFEGKDSY
YYSYYYYQNRYYASHYKSDKSDSEHGKEEEFDSKKTKKKAV
>gnl|bykdb|A0A2E6TCV1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=764 residues).
MNESLEELDGTSSHVPSGAPGPKLKGVIEYLLIIRDRWLLAIALSLPISLWYVYDRYQEPELFRSSATFVIQPPLSIIDN
MQPIERDKYSARIVGDHLHRLKEKELRQRVVKAIESDKAKKSILLAPYVKDKKEQEVLPTVGQVVNYKIDLIGKGTPTLQ
ITAEARNAEGAQLVANLVQIEYERAHKSRKGQNQTKSVAFLDIQMAESRKKEDAIIKQINSFKTNHNLTYIEDDKKDNAE
RKSQYQNAITTADVKLLEIDSHLVSIRGIHNKVVQSLKALTATGPARTTAKIKIIEDFFKISAIAEYGNVNSLRTELQEH
EKTRKTYEAKYLENHPKMKENALAIGELHKILLNEVQVAIEDLTNQKNELNVQKAKFVYLREKIKKQAQQLGQKEQQIAR
LEQDLTLERQTFSSLHKRKKEVEVTGALPEAQTDPLQISDVATVPYLPVSPDKAAIKTKGILIFFACFVLIPIAFEFIDN
RVKSPWDIEVFIGRDLVAGIPKISTIKEADRPLIVGNELDDSLMESFRSMFSRMQMNSHIDYPKSMLITSAIPSEGKSLL
AANLAYSCANHGRRTILIDFDLRRPGLHKFCGVSNDRGLLTLVNEINGEHGTEAERNALTEIYPNLYVLPSGGKTRAATE
MLERPDFDHLLNNLKKLCDILIIDSPPLALFPDSMAMARKVDEVLFVTRYGKVARKVVKNLLTRVDETGANILGVVLNDL
PEKKTPGYYYAGYYGYGYFRYKYYNKYYGGKEGAESELPREKAS
>gnl|bykdb|A0A2E6TNA4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Puniceicoccaceae bacterium] (length=755 residues).
MDDNLEDIDRSLSTKPKGRVRGISDFLLIIRDRWLLALTLALPIALGFVYKELQVPEFFRSESSFRLIPPVEVINLQKVD
RSSQINTLISRHLDGINSQELRVNVVQKISENPEYKSILLAPFLQAGIPTGVASTVSYSVGVTPPSAGNPRFTISAVSRS
ARGAQIIADTVQSEYEKLHKSRKSEKVESARNLLELLLENRQSEERRIAQEMSQFKKGKNIPYLEDAKNSIFARKSQYQS
EITKSKLEQIKITTLLKQIINVRXNXGXQNESXKSQDXEXDXAXIKEXFXIDAIESYGXVPAXRKNLFDLEKTRRDYQEL
EPGYLERHPKMLXNAKQVKDVKKELAXEVKSAIDDSRDKLLELEHQEGEFTKAMQKVQLQSNELSEIEERLEDYKRELSV
VRASTDQIHKRLNDVKIEQSLPSEQDDPLHKEQFASLPGGPFSPDKNAIKQKGLIIFFVVFIIVPILLEIVDNRVKSPWD
VDVFIGKDLIGGIPQISQVEETKRPLIVGNDLDDGLTESFRSMYSRIQMNSNADHPKIILVTSAIPSEGKSLISANLAFS
CANHGRKTILIDFDLRRPGLHKFCSISNDKGLLTLINEAKNGVENLHELADKTLHPIHDNLYILPSGGKTRAATEILEST
EFEMVTNHLKSLAEVIIIDSPPIGLFPDSLAIARKAEEVLFVTRYGKVSRKVAKNLIENIEETGANILGVVLNDLPQKKT
PGYYYSGYYGYGYFRYKYYYKYYGSEKDTSSKIEA
>gnl|bykdb|A0A2E7ALI1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseibacillus sp] (length=597 residues).
PPASYLPDWITGFLNRGKRALPETGSNTSNHQKKLVSLLKNRCEVTVRRRTRLLDVRINHEDPKVSAELADTVVDEYLKE
LTEENRGTKNKRSEGLVKQAEEARVGLQEATSALAIYNRAIEAHKLLELEAIKVSDLARRYRAKHPKMISTVAKLEDSRK
KFMSEFLVAASSAADKSYWEGAGAELQQIANDEEAGLASARRLLLARTQVLDGETKSRMSVFNSILVALEETKVNSIDDE
VIAELHSRSAVPSSPVFPNRLRVKAVGGLGGIAGGLGLVFLLLRLDNRFRTVSQVEEETGMPVLSAVPVLELRKIEAAEK
SHKKKEKEDSGAEASSEKALNFSQDVVFRDGLYSSLYAESYRILRAAVMLLGDEKERKITAFSSALPGEGKTTTSINYAL
ATASQGKKTLLLDMDLRKPKVHRQFNLRRSELEKGMSEVLSNQCTPEEALTKTPGIETLDAIFAGGKAPNPGELLREGMI
EKLFDWAREHYDHVVIDTAPVLAVPDTRIIXPLVSNPXLVVRANVVPKPAVFRALEMLEEDGSRVVGIILNGYRESRRLX
GXXYSYGSYRYGKYGYSQYGYGGYGSYGSYGSDDDED
>gnl|bykdb|A0A2E7HPU9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=735 residues).
MRRKKYYEHDEELDLLDEEDGLGGGTSRRARTRQLIGDILVRWHWMALGLVLGLLGSFYYLSKAPKLYEATSTLLVKDSA
RAAFEGQRQDNADINLRSQEALGTIVEQIKNFELFEKIAKDPDVLALEGLIPPSVNWWPEWSGDLLGGDGEAAIEASKME
TSQLARLIRGWTEVSNRRKTRLVDVVVSHPLPEVASALADKISQTYANELGVERATGRTNSSSVLAQKSEEAEKLLNQKE
NALANYQIILLTLEDLEKREATFSELDLRYLSKHPKLIAAKNALEEYAFRFLREFDQVRKAAADKSYWDKNKSEWDKQDL
DQLSRLQVARRLLTARATVLTSGIASQREVYNSLNTQLAELNAKKGETAVEVELDSFSELPRKPSSPKQLTTLGAGTILG
SVLGFALAFLLANLDNKFHTVSQVELMSGLPILATIQHIDLKVLAQLKDEKEKQLKVSDPPGIELWDSRLIFRPALLQTL
YTEAYRILRASVTLLGKEDERKVSLFTSSIPGEGKTTTSSNFAIAAAQQGKKTILVDFDLRKPAVHKAFGLKRRDLPTGL
TEVLTGKATLAEAIQEQAGQENFSIIFAGQKAPNPGELLTTEGVVAVLKELKQEFDVIVIDSAPLLAVPDTRLLVPEVDN
FCLVVRAEHTPKGAVAKCLDMLRDDDNEPAGIVVNDYQERGGFARKYLYKYGGYGGYGGYGGYGGYGGYGQYGGGYGSGS
YGSYGSYGADEEEDD
>gnl|bykdb|A0A2E7HSS8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=756 residues).
MEEDFDNFSTPPQPKGKPKIKGVSDFLLIIRDRWLLSLALSLPFALGFVFVKQQVHEYYRSSSSFSLIPPPAILNLRSVD
RDQHVEGLIAKHTEGLNSQQLRTNVILRLRESPEYKSVLLAPYLKDGVIVDLASTVSYRVDQSGTKSRPRFIITSDSRSA
KGAMIVADLVQKEYEKLHKSSKSEKVEFVKKTLEDLLENSLSKERKIAYDMSEFKKVNQLPFLEDEKRDTGTRKSQYSEE
VTKSRLEQIRINSLLRQILAIKTRIGSGSDSVSSKDVNDDIAVIKEFFEIDAIEEYGNIPSLRQTLYNLEKTRRDYEETG
SGYLEKHPKMLENARNVLQVKNALKDEVTSSIEDLRDKHIQLSAQEKEFGDEMAKVQLESEKLSEIEDRLKNFTRELAVV
QRSTDGIQSRLNEVKIEQALPSEQDEPLRMESFANEPGGPYSPDKQKIKEQGIMIFSVLFILIPICLEFIDNRVKSPWDV
EVFIGNDLIGGIPKISEIEERERPLIVGNDLDDGLTESFRSMYSRIQMNSLSDYPKLILVTSAIPSEGKSLISANLAHSC
ANHGRKTILIDFDLRRPGLHKFCNMENERGLLSLVNEVSQKGGDIDQSVTETLTEIHPNLFVLPSGGKTRAATEMLEHND
FSVVIDSLKRHAEVIIIDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKVVKSLIASIKETGANLLGVVLNDLPQKKTP
GYYYSGYYGYGYFRYKYYNKYYGKSDAEEKRKSVSS
>gnl|bykdb|A0A2E7VDS1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutales bacterium] (length=603 residues).
LRITAIARNGEGAAMIANLAQDEYERIHDVRKGKKHDMAITFLEEQMNKSRKLGQAIDANTRDFKRQHNLAFIEDEKKDV
ADRKSQYQGAITLAQVEKLRIQSTLRQIIAIQGRVEQSTRTTKDNEHARTNDEMEKIKEYFEISAVETYGNVQALRQKLL
DLETTRKAFEVKYLEKHPKMSANTRAVQELHRLLRLEVKTAIKDLTNRVSEMASQESEFTKAMDAVQRESQKLDDIETRI
NEMTREKEIHEKTHDIMLNRLNEVKVTRALPQEDDPLKRDSPAVTPTSPFEPDKSSIHRTGALIFLACFILIPMAFEFID
NRVKSPWDIEVFLGRDLIAGIPKISTIKEAERPLIVGNELDDGLMESFRSMFSRIQMNSTADGPKSILITSAIPSEGKSL
LAANLAYSCANHGRRTILLDFDLRRPGLHKFCGVSNDKGLLTLINEIHGEHGTEPERNALTEIYPNLYVLPSGGKTRAAT
EMLARPDFDILLSNLKKLCDILIIDSPPVGLFPDSMAMARKVDEVLCVIRYGKVSRKVVKNLLAKVDETGANVLGVVLND
LPEKKTPGYYYAGYYGYGYFRYKYYNKYYGENEPQEHGKAKAG
>gnl|bykdb|A0A2E9EYJ1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=738 residues).
MAKQSETKLHALDYWQVAXNRYAVILLTXALVXMTALVIAYLRPSEXLGRVQIXVQREARDIEVFRXTGSVGXXGSDQLP
YMTXMQTQFEIXQSRETXKEVIXNGVDXAGNXXDLKKSWGVPSDEDAYRILKRKVETQDVRGTDLIDIEVYDTDPNLAAD
IANAVADAYRTRRQEEEQSRAQKALALLDQQIKSQEGRLEKARXNMIELMEELNIVDLSLGEPVWLRGSQPNTGTASLVM
AAKQREFAAEEAIQNLRSTIKSLTQLEGAELIKSAVDLGVKNETLNSGWSEYQTLELSRAALIXSGVGVKHPKIVNIDSQ
LNLRMNQLLDAVETHKKALTTQLAMAEQQYENSKESKERTEKMSLQERKQNVRYIEAKKEYELSKEMLNGMQSQLAKETI
DSAGQRTPLVIHELAEPQDVDKPARPNXKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIPKDIN
VLXXEXGLSPDAEAYRILRTNXEFNRKNADAXAITLVSGGAGEGKSTTLVXLAYVCAQGGYNTLMIDGDLRRPQLHTFFN
INNSVGLTNYLTTDLXLEDVILQTAYENLYFMPSGILPADAAGILNSRRMSELIAXVKSRFDLVFIDSPPILGVSDASVI
SSXVDLTIIVIQHRKLPRGMLXRVKQAIQNVGGTAXGVVLNNVDVRSDNXYQYYTSYYTYYAPRNLDPDMESGSIGSPKP
GSKLASXDQNNLSAEDKF
>gnl|bykdb|A0A2E9RV62 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=757 residues).
MDSYSNPDPSQEIIQPASRSRLRGVFDYFLIIRDRWLLATALSLPIALGFVYKEYQQPSIYQSSSSFRLIPPPAILNLQP
VEQANQLVDLVRKHTEGLNSQELRARVLEAIKDNSFKKSTMLAPYVHDQQLPEIASIINYSVSVGGEGRPVFTITATGRS
PESVQLVADLVQQYYDESHKKGAGEIVRGARSVLESLLEKSQSREDSILEEMTKYKGERELPFVEDERLDNAARKSSYHS
EITKAKVEKVRINSLLRQIIQIQASISSRIQNDGASKDVNANIDAIKEYFKIDAIESFGNVPALQKRLFDLEQSHKLYGQ
KYLANHPKMIETARQIKDVERILQLEVKASIEDLKNSYHQLEAQEQEYANEMDKVQVEAVELSEMEKDLEVLDRKLQIQR
GSTDTIQRRLQDVVIQIELPQEQDDPLHKGNIAYPGIQISPNLPEIHKTGFMIFAALFVLIPFGFEFIDNRIKSPWDIEV
FLGQDLIAGIPKISEVKEVDRPLIVGNELDDGLTEAFRSMYSRIQMNSKTDYPKTILITSAIPSEGKSLLAANLAYSCAN
HGRKTILVDFDLRRPGLHKFCGVNNDRGLLTLINETVANPTPNYNFWDSGTLVEIYPNLLILPSGGKTRAATEMLEKPEF
DKMLFSLRQNAEIIIIDSPPIGLFPDSLAMARKVDEVIFVTRYGKVARKVAKNLIESLEETGANMLGVVLNDLPEKKTPG
YYYSGYYGYGYFRYKYYNKYYGKQGAEKAQGKNAKLS
>gnl|bykdb|A0A2G4F7D5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=759 residues).
MATPEPSSDNRPPEPARGGNRGYGSYGSYGNYGAGNGGYGYGNSGAYNRGGAGEGNPIHNYLLMLRERYWWVLLSTLVFL
TLSLLNTYNTVPEYRATGRLRVFRLAPTINGGSSAADDNFKIVSNDDFFTAVEAMRSANIIEGVSKRLTADERKLVLLPY
QGGNIFSGPLTEQEVFAKQRGINPQRQTLVINVDFTHPNRDLARQVARHFCDAIKKYSEDDRLMVTNPLIEKARIEIETL
EDKVRRLYEQKNDLIKNQKLLSIAKDTNTLTTERSVLVKDREETRKQIDENEILVSVIASYEKEGRPLGDIPQIRADSDV
AATQTAISASKIRVSQMIETYTDQHPKLLAEREALKQLDNQLKEAVSQAIKSRRSSLENAKARLEAILRNLLAKEEEFSK
LQAANVELERVDKDIKASEEFLGRMKLSYEEAKLRSSTSGTSTSISILDQPSVSDKPINKNYYFNALVGVGSGLLFGVVL
IVVIGTLDSRIKSAKDVEDSLGLPLIGTVPRIANVSGPDRALLARQDKDRIATEAVRSIYSALKVNPAVSKARVFLVTST
RPSEGKTFIATNLALIFAQHSERVLIIDADLRLPNVGPSLGFTGDGGLSKWFNGEMSIDEAIVHDVASGLDVLPVGLSCK
NPTQVINNPKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLARLREAQAPLLGVV
LNAMSLRMASAYTDTYDSSYRKYYVDEPRGQSGAGSEKS
>gnl|bykdb|A0A2G4GZA6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=761 residues).
MPNPDPLSDNRPPEPARGGNRGYGSYGSYGNYGAANGGYGYGNGNYGAYNRGGAGEGNPIQNYLLMLRERYWWILLSTLV
FLTLSLLNTYNTVPEYRATGRLRVFRLTPTINGGSSAADDNFRIGSNDDFFTAVEAMRSANIIEGVSKRLTADERKLVLE
PYQAGNIFSGPLTEQEVFAKQRGINPQRQTLVINIDFTHPNRDLARQVARHFCDSIKKSSEDDRLMVTNPLIEKARIEIE
TLEDKVRRLYEQKNDLIKSQKLLSIAKDTNTLTTERSVLVKDREETRKQIDENEILVSVIASYEKESRPLGDIPQIRADT
DVAAVQMVISASKIRVSQMTETYTDQHPKLVAEREALKQLDLQLKESISQAIKSRRSSLENAKARHEAILRNLVAKEEEI
SKLQAANVELERVDKDTKASEEFLSRMKLSYEEAKLRSSNSGTSTSINILDAPSVSDKPINKNYYLNALVGMGSGLLFGV
VLIVVIGTLDSRIKSAKDVEGSLGLPLIGTIPRVANVSGPDRALLARQDKDRIATEAVRSIYSALKVNPAVSKARVFLVT
STRPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVGPSLGFTGDGGLSKWFNAEMSLDEAIVHDVSPGLDVLPVGLS
CKNPTQVINNPKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKVDGVLYVVRYNTVNLRNATSCLARLREAQAPLLG
VVLNAMSLRMASAYTDTYDSSYRKYYVDETRSQAGADSTKS
>gnl|bykdb|A0A2G4GZN8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=780 residues).
MPTPDPSSDNRPPEPSREGNPGYGSYGQGYGQGYGQGYGQGYGAYGAGNYRGGNYGGGNYGYGNNPGYGKGGAGESNPIQ
NYLLMLKERYWWILLASLVFLTLSLLNTYNVVPEYRATGRLRVFRLSPNINGGSSAADDNFKIVSNDDFFTAIEAMRSAN
IIEGVSKRLTVAERKQVLEPYQGGNIFSGPLTEQEVFARQRGINPQRQTLVINVDFTHPNRDLARQVARLFCESIKKNSE
DDRLMVTNPLIEKARIEIETLEDKVRRLNEQKNGLIKNQKLLSIAKDTNTLTAERSVLVRDREETRKQIDENEILVLVIA
SYESEGRPVGDIPQIRADNDVAAAQTAISGSKIRVSQMTETYTDQHPKLVAEREALKQLERQLKEATTQAIKSRRSSLDN
AKARHEAILRNLLAKEEEISRLQAANVDLERVDKEIRASEEFLGRMKLSYEDAKLRSSTSGTSTSISILDAPSVSDKPIN
KNYYFSALVGIGSGLLFGVVLIIVIGTLDDRIKSAKDVEGSLGLPLIGTIPRATVTSGPDRALLARQDKDRIATEAVRSI
YSALKVNPAVSKTRVFLVTSTRPSEGKTFVATNLALLFAQHSERVLVIDADLRLPNVGPSLGFTGDGGLSKWFNAEMTLD
DAIVRDVAPGLDVLPVGLSCKNPTQVINNPKFLAMIEELRGRYDRIFIDSPPIGAVSDALHILPKTDGVIYVVRYNVVNA
RNAVSCISRLRDAHAPILGVVLNSMSIRMASAYTDTYDSSYRKYYVDEPRGATDSDSAKS
>gnl|bykdb|A0A2G4H1E7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=761 residues).
MANPEPSSDNRPPEPARGGNRGYGSYGSYGQYGQGYGAYGAGYGSYGGGPRGGAGGASPISNYLLMLRERYWWVLLTSLV
FLTLSLLNTYNTVPEFQATGRLRVFRLAPTINGGSSAADDNFKIVSNDDFFTAVEEMRSANIIESVSKRLTTDERKQILE
PYQNGNYFSGPLTEQEVFAKQRSINPQRQTLVINVAFTHPTRDLSRKVAQLFCEAIKKNSEDGRLMMTNPLVEKARIEIE
TLEDKVRRLFEQKNDLIKNQKLLSIAKDTNTLTAERSVLVRDREETRKQIDENEILVLVIASYEQEGRSLGDIPQIRADT
DVATTLTALSASKIRMSQMTEKYTDQHPTLVAEREALNQVDRQLREAVVQAVKSRRASLENAKARHEAILRNLVAKEEEI
SKLQAANVELERVDKDIRASEEFLGRMKLSYEDAKLRSSTSGTSTSISILDAPSVSDRPINKNYYYAALIGFGSGLLFGI
VLVFVLGALDERIKSAADIEGSLGLPLIGTIPQVVRASGPDRALLARQESDRIATEAIRSIYSALKVNPAVSKARVFLLT
STRPSEGKTFVATNLAMIFAQHSERVLIIDADLRLPNVGPTLGFTGDAGLSKWFNGEIPLDDAIIREVAPGLDVLPVGLS
CKNPTQVINHPKFLAMIDGFRERYDRIFIDSPPLGAVSDSLHLLPKVDGVIYIVRYNAVNLRHATSCLARLREAQAPLLG
VILNAMSLRMASAYTDSYDSSYRKYYVDERGASSSPGPPKS
>gnl|bykdb|A0A2G4I5Z5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Pedosphaera sp] (length=568 residues).
MTRLIDVTVELGDRVLSQTLAQAVVDEYIKQINEDRAGIGTNTSQFLMGEEIRIKAGLLKAEVAVQEYLKTNSSSLIQGQ
NIVTEEFKSLSERRSAATDERRDMERDFEMTRRVGGKVSELLILASISRAPEVAALKEKLQVQEATLANHQLRYREKHPE
MIKAKTELESIRQQFEVEVLKAPLRLNQQLQAAIDKEKGLELAVKEQEKKLSLLNSQRSGFDHLQAEVMQNRKLHDTVIQ
RLKELDIVSGNKNKNEVRIIEPASLPLTPIRPNKKMLLIYALALGTALSVGLIWLLVQLDTTIKSVDHAERLLGIPVLGA
VPKNKLIKNGKGRLFISDDPQSLCAEAFRSMRASLGLLGRDEDRKVVFFTSAVPSEGKSFCCVNYAVCYAQQGRRTLIID
FDLRKPTLAESFGVEGEHFGVSDVLLGKVPLDQCVQKTRFDNLFLLTAGTMVPNPAELLSGQWTAKLIQEASAKFDHVVL
DNAPINAVSDALLIVKEAQTVCLVANAGKTSYRVVLRALEMLRRAGAKPSGVVLNFLPQSAGSGYYYYYSGNKYYGQKGV
YGASTPRS
>gnl|bykdb|A0A2N8IR72 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=603 residues).
MTDAWNGKAVIVRHSPVLETANALLRGLTITRPDSKESSLLEMTLTSSNPQKAEDTLNHLIQVYNQISKDERNKASLKTK
IFIRDRLKELGASLSDVDKKLTEFKTKSDIVKDADTTMSADFSTSQALEKEIFDLETQIKLASTLADNLKESERKHGLIS
VETGLPDSGIARQIEHYNEAYLEYQKIAGSAGSQNPIAVSLRDRMNSTRAAANKALSNYRSNLDLKLNQLIDKRNSLTER
LTETAIKEQEIIPLIREHKVKEELYLMLLSKEQENALAMAVTESNARVLETAHGSNLPISPKTIKYVAGGTAGGALLSIL
AFMGAAMLNNKVNNKHDLPAANRQPVIAELPQMSKKESKNTKLFIQDEHSVIAECFHILRNNVDSMLPRPEQGGHVILVT
STLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLGGSGRKGLTSILLQQTTDTTGIIRPLGENSRGMDILYT
GPMVPNPVTLLSHPLLGHILGILKKQYDAVIIDAPPYGILADTAILASLSDITLYAVRSGKIDKRYLLQIQQLADQGKLP
NMAYIINGVNFKSASYSYYGYGYGYQYGYGTKEPQQTSRKQNK
>gnl|bykdb|A0A2N8IV96 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=662 residues).
MVATSNVTANYIPMQYSVLTSAEVLKVVSRKLNLAAEWGMTDEMAATNLAGMIKVAPVRATDLVDVIVSGPDPKLVQNIA
KAVPEAYKQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTSWRNGEHRSTLTAGMEEEEFRNAK
AQAMDFERREKELASYVQELQRLPDDKLLDYVISSDLLNAETVGADALRKTYAEFSDKLKEKENLKSQNIGARHPKMLAL
LETERILGDKLNKELIGLRSSLKSKLEMVAASRKHWEATVAQKEEDLQKHVLQVPMYEQASRDYDAALDQLKELDSRYKD
EIARLRVPREAIEMYQLPTYPAAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNV
PILHSSDVMGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY
ELDNEVGLTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAV
IVSEVDMTLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSADGASSGENADASSMKK
VERSGKAKELAATQSHDSEDLY
>gnl|bykdb|A0A2S7U0Z3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Rubritalea profundi] (length=682 residues).
MDIDPFADDDKEYRSTGAEEPVVSNRIGISNVRQALSRWWIMLIFGVLGYFAALYYMSINPPSSEAIAVLEVNIQTGQLL
GQDLVQERMTPDIILATEASKLMGPAILSATAQSPEVRALRNAIPPEFSFKPRYMRTEEELAFKPASSVEVYELVSSFGS
WITISGRRGTSLIDVRVKHQDAEAARVIADTLLKVYLEKEESQLIGGSDDAFKILKKEADGARLEMELAEKSLQFYVSAI
KLSEQIQEKRNQVIILRQRYLPKHPARIQEEALYTDLLESFGGAIKRSSGKPSEKSYWLEYKDEMDALEKIIDGDGPDKS
DAADKWVLLSQGALASRAKLLNNTSEQTRDKYQSISQRMTEIDVADNQSMNNLKVVEPAFIGLAKESVRLIYLAAGSIFG
IFTGFAAAFGLSILDYKIYDVRSAEEATGLTCMAAIPASSKFGRQDKWQSILSHDPHSANAESIRNLRASVILLGKHDNN
KVLLVTSAIPGEGKTTVAAELAAAFAMNKERTLLVDLDLRRPALSGTFPDLDGGPGIVEVLAGQASIQDVFSDTEIENLT
VVCSGAKAPNPSELLNEGEFNSLLEDLIPEFDRIILDSAPVLPVADSRLLAKHAHAVILVVRTRKTPIGAMIRACDLLKA
SGAKLGGVVVNGMKRTGGSNYLGYKGHGEYGGEEYGYYGGDK
>gnl|bykdb|A0A2T6DSN5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium EW11] (length=727 residues).
MAKASKTTPSKRNEAQSPTKGFNFSPRSLLNMFLERWWIGLIAGALGAVAFVLAQPKQDPVYWTEVQLLFEPKEKKVLNI
TEVVDTTTSSSLDLHTHLARLRSETFLDYVQQSFSPKEIEMIQNPYRDPQNANAPVPSVRNIVRSAIQIRDDKATTIVRI
GAYHRDPEAAALIANRFARKYIDFMLDEAMSGTTSAILWLRNQAEETRSQLEAATRELQEFRERHNMASVGENKGVIAQK
VVQLGQSLVGIELEQTNLRTILETIETYQKNNRDLMEIPQIASFGGVGALRGELENLKAERRMLSETYLDEFPKMKENAL
ATENTEKRLQANIELAIAELRSRYEVAGQHEKRLRQDFADAEKRLQELDRATDRYKFLEDDYNRKNQALNSIEGRLQEAT
IVSRLENVNIRILDRANVPSVPANGTPKDTALQASALGLFLLFGIPLGLGLLDTRVKSPSDVEAGLEQVLLGGIKTMKKL
SETERPNVFRLGKDDSLSEAYRGVFSEIEIRSVVPFPKRLLVTSSVPSEGKSLTASNLAAVFAAHGRRTLLVDCDFRRPT
LRRYFGATAGVGLLPWLRENAHRPDVQIDAHKMGIMNIGPAFDLLPAGDAIKNPTEVIDQIASCDLFNKLSKHYDIIVID
TPPSAVFPDALLLSRFCSEMVYVCRFKTVRKALIKKTLHKFAESGIHVLGVVLNCVPSSSVRNYGYDGYGSYESDYYKSY
QSEKVSS
>gnl|bykdb|A0A2T6DX88 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium EW11] (length=718 residues).
MNDLQAKHPSLHTAQGEVLNERRTARDYLIILRERVWIALPIGILVGVILGYLQARVTPLYQSQATMQIEKPEKIVTSQE
VVDLSVTNDIDLNTYLQVLNSTKLRTKVMESFTPEEVKVIQRAYLKNLKPGDPLPGVGSMLGSTSVQSVRNSFIIRIVVS
HPDPEAAALIANRTVDQFMQYLLDSVSGKNEYAVERLRLSAEQLRKEAEAADQKLQSYMREHNLVSLDNSVNIVSDRLKS
VNAALQTARLERLSIEEQVNQVASYKREGRDLLQISSIANHGTIPAIRTQLADLQRQQSVLSERYFERHPKMMDLARAIK
VSQDQLASAIDLAIADLQASLEKARANEKSLEQEYQLHEKEQMHLRDLAVDFRSLENQATVAKSNYSQILDRLSQTTTSS
KLEKIPVRPLDRATPTPAPYTPNMTRVIRLSVIVGLLVFVAVAFGLSIVDDRIKSAWDVESFIGVTLLGIVPDLSSLKDD
EKYSLVRRSEEAPGTESFLSIYSSVKIHSKLDFPKAILVTSTIPGEGKTLVSCNLAASFARHGKSTLIVDCDLRRPMLHR
RFGKENEAGLLTWFEKGGKVEGDLANDPTLGIVKLEDNLSLLRSGGRSKIPTELLEDPRFGQLIAKLKNQYDLVVVDSPP
MGAVTDAMLVAERTDEVVYVCRFNHAARKHIRLYIRALQSGKNEILGIVMNGMSTRRIEYYSNYRYYRSYKKYYGTQA
>gnl|bykdb|A0A2V2SDN0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=747 residues).
MENQNHNEPAKANNQLTTPALDLMAPPDHFVATSRLFVRLHRHQVLLREYWWVLALILLVTVVPALVITLATPPAYQSDA
RMWLTGKLDLSEGRLYTEELVNFLGTQADLLRSRVIQERALATVEKQFSNAPPLKPVPGMADFLRHGSSVNAANAEPSEL
FKLKVVESSKSSILELHATGAEPLSTRAFLNAVMAEYLSFKRESREKTSDRAVASLARQVNQLANELKAQQEKMYAFQMS
NNVVFLQEQGSGAGSYLALLNRQLATLRTELQLLQLVQPDQWVEIGSRTRPSGPGEPPAGEASPQDIMAGLTGPQSDLFR
ANQQIRLLKDKRDELSKGLRPMHPKILKLNEDIAAQEKLVEGSRSEVMKQLVNRRDGLQLEVKNLEKVFREWEGKALEAS
RKMVDYDRLRQDVQRTQAAYDKLLSVISTVDVGKSVDQENVSVLEPASPAGRASKLVRNLALAFAMALVLGAGLLWVLSK
LDDRFVSSTELAEDLPEKVIGQVMDIQLVKPEGELRREALAAQRFEFLESFRNIRSCLWFMHQNGNKPKSLLIGSSVPQE
GKSTVALYLAATMAIGGSKVLLIDGDMRRAKLHRHFGVASSPGLAEILNQETYPNYGIVTTALENLSFLPAGAPTLEPGE
LVLRSQFSSLLSDVYSRFDYIIIDSPPVLAADDAATLAPKVDGVLFVVRGSHTSARMVREGLDTLRQRRARVLGVIFNRA
VSSSFEYHHYQRYKDDYRWQPNVTTAA
>gnl|bykdb|A0A2V2SMX4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=707 residues).
MNQPGAIETVSTTQHQHAWRARFFTRLQRLRGLLLAKWWIPALGVALGVGIQASRSITEKPSYVSTGRMIVSMKLSIPEG
QLYTEEMGNFLGTQAALMQSDVVIHRAHLLVIAQNPNFKPQPVSLKVTILPKTTIFLLVGTGDDPVYTQKFLQACMEEYA
NLKAEMRTQTSDKTLSGLSEEVESLRKELKQSSVQLEAFQGSNSVVVLDQQGNSAGNYLTALNQRLAGLKSELELLRTMS
VEQTLERRQQGGGVLPAPEPVADVNNSASSSLSANDSSQNDYFKAKQQIALMEAQKQDWSEFLRPKHPKMVALDEDISRR
RRLLGIFKDQSSEQLQTLQKTLELQIANMERDVREWDAKCLEISRKTAEYQRLKNDSQRVQGLYDRLLATMQTLDVNKQI
NPESVTIYEKATQAYPDRVNLPMKLALGAVAGLGLSLLVMLFVDRLDDRMASFTELQELFDEEILAQIPREGKAREVSGL
PLITQNGSPHSFVEAYRNLRSSLLYMGNGSRPRTLLITSSAPGEGKSLTAENLGAILANTGSRVLLVDGDLRKGVLHSRF
GLDAMPGLTEVLADGKPVRDVIRETTIPNLWLLPRGSTTHHSSELFISQAAADFLKNAAMQYDYVIMDTAPVMAADDVAS
LAPNMDSTIFLVRAEHTSARVARAALDILYQRRVKVMGLVFNAVRPTTADYYYSKYSEYYRTYPGKG
>gnl|bykdb|A0A2V5NH62 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=723 residues).
MPAPAPATTDRPVSAPWSTAFITRLHRYKALLQRRWWIPVLTICLGLFVQAWFIYQTPPSFESRSKMMLAGKLNISQSAV
YSEDSVNFYGTQIQLMQSQEVRKSAEQLVRSTHPEMQPVMVEISVVQKPRTSIFDLVAIGTTPDYTQAYLNAVMQKYLDF
KKGMRENQGSTVTTAITEQLIQVEKDLRGAEDEMIEFQKQNNIGFIQEEGNSAAAYLVRLNQQYAQLKTEYDLLSLLDLD
QNLDRAQGKNDMPSAPNTQSNDDKPPGMAFSDVGPEGDYLKAKQALQLLKAERETLSKDLRPKHPKIIKLNDEVTKQEKL
IELYRQDTVEKLDTRRKSIGKQMENLQTNIKEWETKALDLSQRLAQFNRIKGKAERLKTLYDRLTNSLKDVNVSQSVDSG
DQVSIMEMASGPVSVRPGLIKSLLIGLGIGALAGIAILLLLDRIDDRMASFGEFQHHFSENVLGQIPKEKTKGRVSLLQP
DDARHVFAESYRNVRSSIFFMPYEGPRPKTMLVTSSVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALREAFGISS
KIGFSEVLKQEVNWQEVVVPTTYENLFVLPRGKTLGQPSEHLLRDSTDALLRDMYNHYDYIIIDSSPVLAADDSTSLAPK
IDATLFVVRLSYTSARLTRKSLELLYNRQVNVPGVILNYVDTSLPEYYYYQYSEYYNTPVPVEEHDDVAAAHRHHQPRQI
QSS
>gnl|bykdb|A0A2V5NYE2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=420 residues).
HPKIIAATEEIAHLERLLPIYREQSNEQLTNKLNSLDMQIKNRRKDIKEQEEQVLEINRKTAEWQRLKDNKQRIQAAHDS
LQATMDKLDVGKEAAPESVTIHQKASPAVPNRPQLSRKLATGALVGLALSVVLLLILDRLDDRVNSVTELQDLFDEPILG
QVPQERAPARRAEIKLIEPEDSRHSFLEAYRNLRSSLLYMVKASERPRTLLVTSSEPNEGKSLTSANLAITMANSGSRVL
LVDADLRKGVLHTLFGLPSGPGLSEALSQGLNWSEAVQATRTPNLFLLPRGAITHKSSEFFIGEVTERFLRDAAAKYDYV
MIDTAPVMAADDVTSLAPHLDGVLFVIRAERTSARVGRAALELLYHRQVSVLGLVFNGVRPSSVDYYYYYKYKDYYKAYP
TSPSQSAATASPKREQAHRA
>gnl|bykdb|A0A2V5PIJ4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=718 residues).
MGNAAPDHPVSPIWTTKFVTRFHRYRALLLRRWWILLLTVCMGLFVQAWMVYQRAPSFLSRSKMMLAGKLNISQNAVYSE
DSSNFYGTQIQLMQSDQVKQGAEGLVHSTHPEMPTAPVEITVSQQSRTSIFDLRAVGAVPEYTQAYLNALMQKYLDFKKG
MREGQGHNVTTAITEQLIEVEKDLRTAEDELLEFQKQNNIGFIQEEGNSAAAYLVKLNQSFAALKTEYDLLSMLDLDQNL
DRKQVQPDGAGSTNTQPSDDSAGMAFTDRGPEGDYLKAKQALQVVKAERDTLAKDLRPRHPKILKLNDEIAKQENLIKLF
REDSIEKLDTRRKSIGVQMENLEKSIAEWEKKALDLSQRLAQFNRIKGKADRLKTLYDRLTNNLKEVNVSQVVDTGDQIA
IMENATAPVSVRPGLIKSLLMGLGAGILGGLAVLFLLDRIDDRMASFGEFQHQFSENVLGQIPREKVKGDVMLLQQDDAR
HVLSESFRNVRSSIFFMPYEGPRPKTFLVTSAIPNEGKSTVSANLSITMALAGARTLLIDGDLRRGALRDAFGVSSKIGF
SEVLQQEVNWRQVVVPTSYPNLFLMPRGKTIGQPSEFLLRESTDALLREINTFFDYIIIDSAPVLAADDATSLAPKIDAT
LFVVRLSHTSARLTRKSLELLYNRQVNVPGVILNQVDTSLSEYYYYQYAEYYNTPEPVDERAAPAALHHREPKQIQSS
>gnl|bykdb|A0A2V5U130 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=762 residues).
MNNNNHPNAAAVDLFAPADRFVSASRLYGRLHRWWLLLGRYWWVIVLILVLVLGPVGVLSFNSLPAYESKARMWLTGRLD
IYEGRLYTEELINFLGTQAELLRSPAIQGRALARLRSELNPDLAVLLDGGGRQSELLHKPKALCKRLFASGSTSSSNAPP
RFPFDVKVLEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFKKESREKTSDRTATSLGAEVTQLKGELEAQQEKLHAF
QASNNVVFLQEQGNSAGSYLASLNKQLATLRTELRLLQSLQPEQWIETGHKGVPAGESLPDPATEKEMLASLAEPQLELF
KANQQMQLLKAKRDELSRFLRPLHPKILKLNEQIATQEKLVQISRDEALKQLAHRRQAIELQVQNLEAAFKEWDAKAIES
SRKMADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKVEQENVGILEPASVATPTHRVLRNMAIALIGSLLLGFGLLYCIG
LFQDDFASLAELTNQLCEEVVGQIPAISIKKPRRQLGVEALEKQRFEFLEAFRSIRSSLLFMSNGGTKPKTIIVASSVPE
EGKSTVALYLAATLARANSRVLLIDADLRRATLHTFFGTAPRPGLAEILNEEISFAEAIVPTGLENLALLPAGEANRNPG
ELVLSQVWPGFLAEAKPQFDYILVDTPPVLATDDAASLAPKVDGVLFVVRGSFTSARMARGALDALRQRHVHVLGLIFNR
AASSPYGHDYYQRYRRAYRWEPKETRRATALAGHSAPDATGG
>gnl|bykdb|A0A2V5U7A0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=466 residues).
NRALYESVLKRLSETNVSNDIAVSNMQIMQSAERPRSPDAPNIPINLTMYAALGLFLGVGMAFALEYIDSHLNTPEHVWR
AVDLNTLGVVPDLDSLGHRPLISYAPASRAKLLPTRMGQTQLDDISTRGKDLIVAHNPLSIYSEAYRTIRTALLLSQPGG
NRKVILLTSPSPGEGKTATTLNLGIALAQDGYRILIIDADLRRGSCHSRIGLRNHRGLSNVLGGEMPIEQLIQPTSIAGL
SLVTRGVCPPNPSELLGTRKMKELVMDLRESYDFILLDTPPAIAVSDPAILSSVADGIILVFHARKTTVHSARQVKERFD
AVRGPILGVILNGINVEDPDYAYYRHYYGSDYGTVAAAENGNGGEHADVEVLMAHDSFEKDPWPKIAASEIVPQNFFDHI
VSKLRDAVGPMAGLIVEDHISLLGEARNRFPKNRLHELFDRICEEILDDKLKNDFQQSMQEELRVL
>gnl|bykdb|A0A2V5UAD5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=536 residues).
NALMIEYIQYKKDIRKVVSGDTLASISEQVLRLERDLKSEQENLVAFQRTNNLAIVQQEATIAGGSLARLSTELSDGILQ
TQLLESRALGLEANGPVGAGVSVGLNGPLLGADSEIPSTGTSERQGASRDLELLKLQRERLSKFLRPKHPKIAQLDTQIQ
RAEKLIELFRNQSREQIAAAQQVLKLKMNGIQTSIKESLGKVLAANDRIADAERMKMNISRIQFHYDRVVNLLQNVDISR
NIDQGTLAILDPASEAVRSYKQDVSLLAMTLVAGLLAGFGCVFLVAVRDDRFITLTDVIEKLGDAVLGQVPEVRKRRRKS
PLPLLEIDDDRHVYAESYRNLRSALLYQGTDGQRPRVLLVTSAVPNEGKSTVAANLARILALGGSRVLLVDGDLRKGALH
ELMGMNHEPGLSEMLRCPEDLEKIIQTNSLPNFFFVSSGGRLSNPGDLFLNPALSQVLAWARQHFDYVLIDSSPVFAADD
TATLAPMVDGTLFVVRNRFSRPRPAREALELLFQRQAKVLGLVFNRADASARSHYY
>gnl|bykdb|A0A2V5VGZ7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=762 residues).
MNDNNHNQPNTPAVDLFAPANRFVSASRLYGRLHRWWLLLRRYWWLIVLILVLGLGPAGFLSFNSPPAYESKARMWLTGK
LDIYEGRLYTEELINFLGTQAELLRSPAIQGRALAKLRSERNLAVLHNGGGTQSELLHKAKALCKKLIASGSSSSSNAPP
RFPFDVKVLEGAKSSTLALRVIGAEPASTRAFLDCLMEEYLSFKKESREKTSDRTAASLAAEVTQLKSELEAQQEKLHAF
QASNNVVFLQEQGNSAGSYLASLNKQLATLRTELRLLQSLQPEQWIEAGHKVVPSSESLPDQATEKEMLASLAEPQLELF
KANQQMQLLKAKRDELSRFLRPLHPKILKLDEQIATQEKLVEISRDEALKQLAHRRRAIELQVQNLEVAFKEWDAKAIES
SRKMADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKVEQENVGILEPASVAAPTHRLFRNMAIALVGSLLLGFGLLYCIG
LFRDDFASLAELTHQLSEEVVGQIPAISIKKPKRRLGVEALEKQRFEFLEAFRSIRSSLLFMSNGGTKPKTIIVASSVPE
EGKSTVALYLAATLARANSRVLLIDADLRRATLHTFFGTASSPGLAEILNEEISFKEAIVPTGLENLALLPAGEANRNPG
ELVLSQVWPGFLAEAKPQFDYILVDTPPVLATDDAGSLAPKVDGVLFVVRGSFTSARMARGALDALRQRHVRVLGLIFNR
TVSSPYEHDYYQRYRRAYHWEPKETRCATALAGHSAPDATDG
>gnl|bykdb|A0A2V5W206 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=714 residues).
MQATTAGKNLSTSWSTVFITRLHRYKSLFLRRWWIPVLTTCLGLFVEAFLIYQMPPSYLSASKMMLAGKLNIAQGAVYSE
DSVNFYGTQIQLMQSAEVRHSAESLVRSAHPELQPVPVEITVLQKPRTSIFDLAAVGSAPEYTQAYLNAVMQKYLDFKRG
MREDRGHEITTGITEQLIQVEKDLRNGEDEMLEFQKQNNIGFIQEQGNSAAQYLVKLNQQYAQLKTEYDLLNLLDLDQNL
DRAQNKTEAASGQGSDNQGMPFSDVGPEGDYLKAKQQIQLLKAERETLAKDLRPSHPKILKLNDEITKQDKLIQLFRADA
LEKLKTRRESIGKQMENLQANIKEWEAKALDLSQRLAQFNRIKGKVDRLKTLYDRLTTNLKDIDVSQVTGSEDQVSIMEM
ATPPISVRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSENILGQIPKEKTKGKVDLLQPDDARHVFA
ESYRNIRSSIFFMPYDGPRPKSFLVTSAVPSEGKSTLSANLAITMALSGARTLLIDCDLRRGALRETFGISSKIGFSEVL
KQEVNWREVVVPTAYETLFVLPRGKTLSQPSEHLLRESTEALLKEMYQHYDYIIIDSSPVLAADDTTSLAPKIDATIFVV
RLSYTSARLTKKALELLYGRQVNIPGVILNFVDTSLPEYYYYQYSEYYSTPTSVPDGEAVAPVRRQRPKPIETT
>gnl|bykdb|A0A2V5W3Y0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=236 residues).
AESYRNVRSSIFFMPYEGPRPKTMLVTSSVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALREAFGVSSKIGFSEV
LKQEVNWQEVVVPTSYPNLFLLPRGKTLGQPSEHLLRDSTDALLADLYNHYDYIIIDSSPVLAADDSTSLAPKIDATLFV
VWLSYTSARLVRKSLELLYNRQVNVPGIILNYVDTSLPEYYYYQYSEYYNTPLAVEEPDDVAAAHRHHQPRQIQSS
>gnl|bykdb|A0A2V5X6Z6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=751 residues).
MNNNNHPNAAAVDLFAPADRFVSASRLYGRLHRWWLLLGRYWWVIVLILVLVLGPVGFLSFNSLPAYESKARMWLTGRLD
IYEGRLYTEELINFLGTQTELLRSPAIQGRALARLRSELNPDLAVLLDGGGRQSELLHLAKALCKRLFASGSTSSSNAPP
RFPFDVKVLEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFKKESREKTTDRTATSLGVEVTQLKGELEAQQEKLHAF
QASNNVVFLQEQGNSAGSYLASLNKQLATLRTELRLLQSLQPEQWIETGHKGVPSGEMLASLAEPQLELFKANQQMQLLK
AKRDELSRFLRPLHPKILKLNEQIATQEKLVQISRDEALKQLAHRRQAIELQVQNLEAAFKEWDAKAIESSRKMADYEQI
RQNLQRLQTAYDKTLTLIQTVDVSKKVEQENVGILEPASVAAPTHRLFRNMAIALVGSLLLGFGLLYCIGLFRDDFASLA
ELTHQLSEEVVGQIPAISIKKPKRRLGVEALEKQRFEFLEAFRSIRSSLLFMSNGGTKPKTIVVASSVPEEGKSTVALYL
AATLAKGNSRVLLIDADMRRTALHKFFGAASSPGLAEVLNEEISFAEAIVPTGLENLALLPAGEARQNPGELALSPVWLS
FLAEAKSQFDYVLVDTPPVLAADDAATLAPKVDGVLFVVRGSFTSARMARGALDALRQRRVHVLGLIFNRAASSPCERQY
YQRYRRAYRWEPQKSGRVALAGNLSPNTTDR
>gnl|bykdb|A0A2V5XFN9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=714 residues).
MPASTAAKSLSTSWSATFITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLIYQTPPSYQSTSKMMMAGKLNIAQGAVYSE
DAVNFYGTQIQLMQSAEVRRSAESLVRSAHPELQPVTVEIFVIQKPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFKRG
MREGRGHEVTTGITEQLVQVEKDLRNSEDEMLEFQKQNNIGFIQEEGNSAAAYLVKLNQQYAQLKTEYALLNLLDLDQNL
DRAQNRTETAASNQPVENGGLPFSDVGPEADYLKAKQQVQLLKAERDTRAKDLRPNHPKIIKLNDEITKQDKLIELFRAD
TLEKLKTRRESIGKQMENLQANVKEWEAKALDLSQRLAQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVVGGEDQVSIME
MATAPISVRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSENVLGQIPKEKTKGKVDLLQPDDARHVF
AESYRNIRSSIFFMPYEGPRPKSFLVTSAVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALCEAFGITSKIGFSEV
LKQEVNWREVVVPTAVPTLFVLPRGKPLSQPSEHLLRESTEALLKEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFV
VRLSYTSARLTKKALELLYGRQVNVPGVILNFVDTSLPEYYYYQYSEYYSTPAAPDGEAVTSVGREHPKPIETA
>gnl|bykdb|A0A2V5ZUK1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=718 residues).
MQVAATRLQNLSTSWSAAFITRLHRYKSLLLRRWWIPVLTICLGLFVEAFLIYQTPPQYQSTSKMMLAGKLNIAQGAVYS
EDAVNFYGTQIQLMQSAEVKHSAEALVRSSHPELQPVPVEIFVMQKPRTSIFDLSAVGSSPEYTQAYLNAAMQKYLDFKR
GMREDRGHEITTGITEQLIQVEKDLRNSEDEMLEFQKQNNIGFIQEDSTSAAAYLVKLNQQYAQLKTEYALLNLLDLDQN
LDRAQTKLDSSSGQASDNQGLPFADVGPEADYLKAKQQAQMLKAERDTLAKDLRPNHPKILKLNDEVAKQDKLIELFRAD
TLERLKTRRESIGKQMENLQGNIKEWEAKALDLSQRLAQFNRIKGKSDRLKQLYDRLTNNLKEIDVSQVVGGEDQVSIME
MATTPVSVRPGLIKSLLIGFGAGALLGLGILILLDRIDDRMASFSEFQHHFSENVLGQIPKEKAKGRVELLQPDDQRHVF
AESYRNIRSSIFFMPYEGPRPKSFLITSAVPSEGKSTVSSNLAITMALSGAKVLLIDCDLRRGAIREAFGIDSKIGFSEV
LKGEVNWREVVVPTAYETLFVLPRGKTLGQPSERLLHETTDVLLREIYQHYDYVIIDSSPVLAADDTTSLAPKIDATLFV
VRLAYTSARLTKKALELLYSRQVNVPGVILNFVDTSLPEYYYYQYSEYYSTPSVPETDAQPVAPPVRRQRPRPIETQI
>gnl|bykdb|A0A2V6C237 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=762 residues).
MNNNNHPNAAAVDLFAPADRFVSASRLYGRLHRWWLLLGRYWWVIVLILVLVLGPVGFLSFNSLPAYESKARMWLTGRLD
IYEGRLYTEELINFLGTQTELLRSPAIQGRALARLRSELNPDLAVLLDGGGRQSELLHLAKALCKRLFASGSTSSSNAPP
RFPFDVKVLEGAKSSTLELRAIGAEPASTRAFLNCLMEEYLSFKKESREKTSDRTATSLGVEVTQLKGELEAQQEKLHAF
QASNNVVFLQEQGNSAGSYLASLNKQLATLRTELRLLQSLQPEQWIETGHKGVPSGESLPDQAAEKEMLASLAEPQLELF
KANQQMQLLKAKRDELSRFLRPLHPKILKLNEQIATQEKLVQISRDEALKQLAHRRQAIELQVQNLEAAFKEWDAKAIES
SRKMADYEQIRQNLQRLQTAYDKTLTLIQTVDVSKKVEQENVGILEPASVATPTHRRLRNMAIALVGSLLLGFGLLYCIG
LFQDDFASLAELTNQLCEEVVGQIPAISIKKSKGRLCVEGLEKQRFEFLEAFRSIRSSLLFMSNGGTKPKTIIVASSVPE
EGKSTVALYLAATLARANSRVLLIDADLRRATLHTFFGTASSPGLAEILNEEISFKEAIVPTGLENLALLPAGEANRNPG
ELVLSPVWPGFLAEAKPQFDYILVDTPPVLATDDAASLAPKVDGVLFVVRGSFTSARMARGALDALRQRHVRVLGLIFNR
TVSSPYEHDYYQRYRRAYHWEPKETRCATALAGHSAPDATDG
>gnl|bykdb|A0A2V6C292 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=710 residues).
MNPPPERPAAAPWSTAFFTRMYRYKSLLLRRWWILLLTICCGLFVEAWLIFQTPPSFQSTSKMMMAGKLNINQGPVYSED
NVNFYGTQIQLMQSAEVRRGAVGLVRSTNPELQPVPVELSVAQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFKRGM
REGQTNTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGFIQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQNLD
RGEKTESSPGASPTDQVGMPFSDVGPEGDYLKAKQQVQLLKAERDTLSQDLRPKHPKIIKLNDEISKQEKLIELFRSDAV
EKLETRRKSIGKQMENLQGNVKEWEVKALDLSHRLAQFNRIKGKVDRSKLLYDRLTNDLKSVDVSQVVDSGDQISIMEPA
TSPVSVRPGLLKSLLLGFGGGALVGIMILLLLDRIDDRMASYGEFQRHFSENVVGQIPKEKVKGTMALLQPDDPRHIFAE
SYRNIRSSILFMPYAGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGVLREQFGSNSRVGFSEVLQ
QEVPWQEVVMPTAYPSLFLLMRGKALAQPSEHLLRESTDQFLKEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVVR
LSYTSARLTKKAFELLYSRQVNVPGVILNFVDTSLPEYYYYQYSEYYNRPVTSSASDAIAQHSSDQAQSF
>gnl|bykdb|A0A2V6D2X0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=684 residues).
MNPPPERPAAAPWSTAFFTRMYRYKSLLLRRWWILLLTICCGLFVEAWLIFQTPPSFQSTSKMMMAGKLNINQGPVYSED
NVNFYGTQIQLMQSAEVRRGAVGLVRSTNPELQPVPVELSVAQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFKRGM
REGQTNTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGFIQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQNLD
RGEKTESSPGASPTDQVGMPFSDVGPEGDYLKAKQQVQLLKAERDTLSQDLRPKHPKIIKLNDEISKQEKLIELFRSDAV
EKLETRRKSIGKQMENLQGNVKEWEVKALDLSHRLAQFNRIKGKVDRSKLLYDRLTNDLKSVDVSQVVDSGDQISIMEPA
TSPVSVRPGLLKSLLLGFGGGALVGIMILLLLDRIDDRMASYGEFQRHFSENVVGQIPKEKVKGTMALLQPDDPRHIFAE
SYRNIRSSILFMPYAGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGVLREQFGSNSRVGFSEVLQ
QEVPWQEVVMPTAYPSLFLLMRGKALAQPSEHLLRESTDQFLKEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVVR
LSYTSARLTKKAFELLYSRQVNVPGVILNFVDTSLPEYYYYQYS
>gnl|bykdb|A0A2V6EBU2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=707 residues).
MNAPLERPAAAPWSTAFFTRIYRYKSLLLRRWWILLLTICCGLFVEAWLIFQTPPSFQSTSKMMLAGKLNINQGPVYSED
NVNFYGTQIQLMQSAEVRRAAAALVRSTNPELQPVPVELSVAQRPRTSIFELQAIGSSPDYTQIYLNAVMQKYLDFKRGM
REGQTHTFTTGITEQLIQVEKDLRAAEDDMLDFQKQNNIGFIQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQNLD
RGEKTQTEASPNPSANDQVGMPFSDVGPEGDYLKAKQQVQLLKAERDTLSQDLRPKHPKIIKLNDEISKQEKLIDLFRSD
AVEKLETRRKSIGKQMENLRGNIKEWEVKALDLSQRLAQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVIETGDQISIME
PATTPVSVRPGLLKSLLLGFGGGALVGIMVLLLLDRIDDRMASYGEFQRHFSENVVGQIPKEKVKGTMALLQPDDPRHIF
AESYRNIRSSLLFMPYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNSRIGFAEV
LQQEVPWQEVVMPTAYPSLLLVTRGKTLAQPSEHLLRDSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLV
VRLSYTSARLTKKALELLYNRQVGVPGVILNCVDTSLPEYYYYQYSEYYNRPVAPSESEAIAQRSSG
>gnl|bykdb|A0A2V6EID2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=716 residues).
MQAPIPAVERSTPAAWSNTLITRLHRYKALLLRRWWIPVLTICLGLFVEAFLIYQMPPSFLSTSKMMLAGKLNIAQGAVY
SEDSVNFYGTQIQLMQSAEVKRSAEALVRSTHPEMQPMRVEITVVQKPRTSIFDLQAIGRTPDYTQAYLNALMQKYLDFK
KGMREGQGQTLITGITEQLIQTEKDLRTAEDEMLEFQKQNNIGFIQEEGNSAAAYLVRLNRDYAGLKTEYDLLNLLDLDQ
NLDRAQNKSEMNLGGQSTEDQGMPFSGVGPEGEYLKAKQAVQLLKAERDTLAKDLRPKHPKILKLNDEISKQEKLIDLFR
ADTVEKLETRRKSIGKQMENLQANIKEWEAKALDLSQRLAQFNRVKGKVDRLKVLYDRLTNNLKEVDVSQVVDSADQVSV
MEMATPPISVRPGLIKSLLIGLGCGLLAGIGILFLLDRIDDRMASFGEFQHQFSESVLGQIPKEKTKGKLTLLQPDDARH
IFAESYRNVRSSIFFMPYEGPRPKTLLVTSAVPNEGKSTIAANLAITMALSGARTLLIDADLRRGALREAFGISSKLGLS
EVLKQEVNWQEVVVPTSYPSLFILPRGKSLSQPSEHLLRDSTDVLLKEMYKHYEYILIDSSPVLAADDTASLAPKIDATL
FVVRLSYTSARLIRKGLELLYGRQVNVPGIILNFVDTSLPEYYYYQYAEYYNPPASVTDDEALTAPPPREPAKQPS
>gnl|bykdb|A0A2V6EY06 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=707 residues).
MNAPLERPAAAPWSTAFFTRIYRYKSLLLRRWWILLLTICCGLFVEAWLIFQTPPSFQSTSKMMLAGKLNINQGPVYSED
NVNFYGTQIQLMQSAEVRRAAAALVRSTNPELQPVPVELSVAQRPRTSIFELQAIGSSPDYTQIYLNAVMQKYLDFKRGM
REGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGFIQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQNLD
RGEKTQTEASPNPSANDQVGMPFSDVGPEGDYLKAKQQVQLLKAERDTLSQDLRPKHPKIIKLNDEISKQEKLIDLFRSD
AVEKLETRRKSIGKQMENLQGNIKEWEVKALDLSQRLAQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVIETGDQISIME
PATTPVSVRPGLLKSLLLGFGGGALVGIMVLLLLDRIDDRMASYGEFQRHFSENVVGQIPKEKVKGTMALLQPDDPRHIF
AESYRNIRSSLLFMPYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNSRIGFAEV
LQQEVPWQEVVMPTAYPSLLLVTRGKTLAQPSEHLLRDSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLV
VRLSYTSARLTKKALELLYNRQVGVPGVILNCVDTSLPEYYYYQYSEYYNRPVAPSESEAIAQRSSG
>gnl|bykdb|A0A2V6EZC8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=714 residues).
MPASTAAKSLSTSWSATFITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLIYQTPPSYQSTSKMMMAGKLNIAQGAVYSE
DAVNFYGTQIQLMQSAEVRRSAESLVRSAHPELQPVTVEIFVIQKPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFKRG
MREGRGHEVTTGITEQLVQVEKDLRNSEDEMLEFQKQNNIGFIQEEGNSAAAYLVKLNQQYAQLKTEYALLNLLDLDQNL
DRAQNRTETAASNQPVENGGLPFSDVGPEADYLKAKQQVQLLKAERDTLAKDLRPNHPKIIKLNDEITKQDKLIELFRAD
TLEKLKTRRESIGKQMENLQANVKEWEAKALDLSQRLAQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVVGGEDQVSIME
MATAPISVRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSENVLGQIPKEKTKGKVDLLQPDDARHVF
AESYRNIRSSIFFMPYEGPRPKSFLVTSAVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALCEAFGITSKIGFSEV
LKQEVNWREVVVPTAVPTLFVLPRGKPLSQPSEHLLRASTEALLKEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFV
VRLSYTSARLTKKALELLYGRQVNVPGVILNFVDTSLPEYYYYQYSEYYSTPAAPDGEAVTPVGREHPKPIETA
>gnl|bykdb|A0A2V6F9Q9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=617 residues).
MQSAEVRRGAAELVWSTHPDISPVPIELSVAQRPRTSIFELQAIGSSPEYTQLYLSAVMQKYLDFKRGMREGQTQTFTTG
ITEHLIQVEKDLRTAEDEMLEFQKENNIGFIQEEGNSAAQYLVKLNQDFARLKTEYELLQKLDLDQNLDRGEKTKTEASP
GASPTDQAGMPFSDVGPEGDYLKAKQQVQLLKAERDTLSQDLRPRHPKIIKLNDEISKQEKLIAVFRADAVEKLETRRKS
IGKQMENLQSNIKEWETKALDLSQRLAQFNRIKGKMDRTKQLYDRLTNDLKAVDVSQVVDAGDQISIMEPATPPVSVRPG
LIKSLLLGFGGGAVAGILILLVLDRIDDRMASYGEFQRHFLENVVGQIPKEKAKGKMPLLQAEDPRHIFAESYRNIRSSI
LFMSYEGPRPKTILVTSAIPNEGKSTVSANLAIALALSGARVLLIDGDLRRGTLREQFNSNSRLGFSEVLRQEVPWSEVV
MPTAYHSLSLLTRGKPLTQPSEHLLRDSTDQFLKEIYHQYDYIIIDSSPVLAADDTTSLAPKVDATLLVVRLSHTSARLT
KKALELLYSRQVNVPGIILNFVDTSLPEYYYYQYSEYYNRSVAVLESEATAQRQPTR
>gnl|bykdb|A0A2V6FIP7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=498 residues).
IVLQALKQAQADLDKARSDAAAARKLDEEVERLLHAATSIDAIPLVAGNPLIQDMRKSLAEREALLANLLKRYKDKYPDV
IRVREEIASLKESIQKESQKVRQAIRAEAELAKAKETTMASELKKKEQESFELSQLRIQYDVLSRQADQSKLLYNIVLQR
MKETDLTSKDKAQNMRVVDKAVVPMNPIKPRVVLTLFLGVIGGLGVAMGLAFFVNYLDDSIKSQDDVETYLRLPFLGYVP
NIKTNSVLERDLQAHLHPQSNAAEGFRTIRAAIALAPKSDQYHLLAITSTIPAEGKSLVASNLAIVTAQTGLKTLLVDAD
LRRPSVHKVFRLQSPVGLSSYLMEKVSRVDEFIHTTEVPHLDVVCCGAVPSSPSELAGSKRMRQFLEEVRNRYDRVILDC
PPVSAVSDPLIIASLSDGVAFVTKFNKIRRDHASRTIQRIQDAGIHILGVVLNDIDFEGKDSYYYNYYYYQNRYYSSHYN
PRPDKPLKDKSEEVKKAG
>gnl|bykdb|A0A2V6I7Z5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=714 residues).
MPASTAAKSLSTSWSATFITRLHRYKSLFLRRWWIPVLTICLGLFVEAFLIYQTPPSYQSTSKMMMAGKLNIAQGAVYSE
DAVNFYGTQIQLMQSAEVRRSAESLVRSAHPELQPVTVEIFVIQKPRTSIFDLSAIGSAPDYTQAYLNAVMQKYLDFKRG
MREGRGHEVTTGITEQLVQVEKDLRNSEDEMLEFQKQNNIGFIQEEGNSAAAYLVKLNQQYAQLKTEYALLNLLDLDQNL
DRAQNRTETAASNQPVENGGLPFSDVGPEADYLKAKQQVQLLKAERDTLAKDLRPNHPKIIKLNDEITKQDKLIELFRAD
TLEKLKTRRESIGKQMENLQANVKEWEAKALDLSQRLAQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVVGGEDQVSIME
MATAPISVRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSENVLGQIPKEKTKGKVDLLQPDDARHVF
AESYRNIRSSIFFMPYEGPRPKSFLVTSAVPGEGKSTVSANLAITMAFSGARTLLIDCDLRRGALCEAFGITSKIGFSEV
LKQEVNWREVVVPTAVPTLFVLPRGKPLSQPSEHLLRESTEALLKEIYQNYDYVIIDTSPVLAADDTTSLAPKIDATLFV
VRLSYTSARLTKKALELLYGRQVNVPGVILNFVDTSLPEYYYYQYSEYYSTPAAPDGEAVTPVGREHPKPIETA
>gnl|bykdb|A0A2V6K2G8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=715 residues).
MQPSTAVKNLSTSWSAAFVTRLHRYKSLFLRRWWIPVLTICLGLFVEAFLIYQTPPSYQSTSKMMLAGKLNIAQGAVYSE
DSVNFYGTQIQLMQSAEVRHSAESLVRSAHPELQPVPVEIFVLQKPRTSIFDLSAIGSAPEYTQAYLNATMQKYLDFKRG
MREDRGHEITTGITEQLIQVEKDLRNSEDEITEFQKQNNIGFIQEEGNSAAAYLVKLNQQYAQLKTEYDLLNLLDLDQNL
DRAQNKMDSAGGANPGSDNQGLPFSDVGPEGDYLKAKQQVQLLKAERDTLAKDLRPNHPKIIKLKDEISKQEKLIELFRA
DTLEKLKTRRESIGKQMENLQTNVKEWEAKALDLSQRLAQFNRIKGKVDRLKTLYDRLTNNLKDIDVSQVTGSEDQVSIM
EMATAPISVRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSENVLGQIPKEKTKGRVDLLQPDDMRHV
FAESYRNIRSSIFFMPYEGPRPKSFLVTSAVPSEGKSTVSANLAITMALSGARTLLIDCDLRRGALREAFGITSKIGFSE
VLKQEVNWREVVVPTAVSTLFVLPRGKTLGQPSEHLLRESTEALLKEIYQDYDYVIIDSSPVLAADDTTSLAPKIDATLF
VVRLSYTSARLTKKALELLYNRQVNVPGVILNFVDTSLPEYYYYQYSEYYSTPTVPDAETVTPVRRERPKPIETA
>gnl|bykdb|A0A2V6ME53 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=707 residues).
MNAPLERPAAAPWSTAFFTRIYRYKSLLLRRWWILLLTICCGLFVEAWLIFQTPPSFQSTSKMMMAGKLNINQGPVYSED
NVNFYGTQIQLMQSAEVRRGAAALVRSTNPELQPAPVELTVAQRPRTSIFELQAIGSSPDYTQAYLNAVMQKYLDFKRGM
REGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGFIQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQNLD
RGEKTQTEASPNPSANDQVGMPFSDVGPEGDYLKAKQQVQLLKAERDTLSQDLRPKHPKIIKLNDEISKQEKLIDLFRSD
AVEKLETRRKSIGKQMENLRGNIKEWEVKALDLSQRLAQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVVDTGDQISIME
PATSPVSVRPGLLKSLFLGFGGGALVGIMILLLLDRIDDRMASYGEFQRHFSENVVGQIPKEKVKGTMALLQPDDPRHIF
AESYRNIRSSLLFMPYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNSRVGFAEV
LQQEVPWQEVVMPTTYPSLFLVTRGKTLPQPSEHLLRDSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLV
VRLSYTSARLTKKALELLYNRQVNVPGVILNFVDTSLPEYYYYQYSEYYNRPIAPPESEATAQHSSG
>gnl|bykdb|A0A2V6MHB0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=716 residues).
MQAPIPAVERSTPAAWSNTLITRLHRYKALLLRRWWIPVLTICLGLFVEAFLIYQMPPSFLSTSKMMLAGKLNIAQGAVY
SEDSVNFYGTQIQLMQSAEVKRSAEALVRSTHPEMQPMRVEITVVQKPRTSIFDLQAIGRTPDYTQAYLNALMQKYLDFK
KGMREGQGQTLITGITEQLIQTEKDLRTAEDEMLEFQKQNNIGFIQEEGNSAAAYLVRLNRDYAGLKTEYDLLNLLDLDQ
NLDRAQNKSEMNLGGQSTEDQGMPFSGVGPEGEYLKAKQAVQLLKAERDTLAKDLRPKHPKILKLNDEISKQEKLIDLFR
ADTVEKLETRRKSIGKQMENLQANIKEWEAKALDLSQRLAQFNRVKGKVDRLKVLYDRLTNNLKEVDVSQVVDSADQVSV
MEMATPPISVRPGLIKSLLIGLGCGLLAGIGILFLLDRIDDRMASFGEFQHQFSESVLGQIPKEKTKGKLILLQPDDARH
IFAESYRNVRSSIFFMPYEGPRPKTLLVTSAVPNEGKSTIAANLAITMALSGARTLLIDADLRRGALREAFGISSKLGLS
EVLKQEVNWQEVVVPTSYPSLFILPRGKSLSQPSEHLLRDSTDVLLKEMYKHYEYILIDSSPVLAADDTASLAPKIDATL
FVVRLSYTSARLIRKGLELLYGRQVNVPGIILNFVDTSLPEYYYYQYAEYYNPPASVTDDEALTAPPPREPAKQPS
>gnl|bykdb|A0A2V6MW77 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=714 residues).
MQVATVGKNLSTSWSAAFITRLHRYKALFLRRWWIPVLTTCLGLFVEAFLIYQMPPSYLSASKMMLAGKLNIAQGAVYSE
DSVNFYGTQIQLMQSAEVKHSAESLVRSAHPELQSVPVEITVLQKPRTSIFDLAAVGSAPEYTQAYLNAIMQKYLDFKRG
MREDRGHEITTGITEQLIQVEKDLRNGEDEMLEFQKQNNIGFIQEQGNSAAQYLVKLNQQYAQLKTEYDLLNLLDLDQNL
DRAQNKTEAASGQGSDNQGMPFSDVGPEGDYLKAKQQIQLLKAERETLAKDLRPNHPKILKLNDEITKQDKLIQLFRADT
LEKLKTRRESIGKQMENLQANIKEWEAKALDLSQRLAQFNRIKGKVDRLKTLYDRLTNNLKEIDVSQVVGGEDQVSIMEM
ATSPVSVRPGLIKSLLIGFGIGALAGLAILVLLDRIDDRMASFSEFQHHFSENILGQIPKEKTKDKVDLLQPDDARHVFA
ESYRNIRSSIFFMPYDGPRPKSFLVTSAVPSEGKSTISANLAITMALSGARTLLIDCDLRRGGLREAFGISSKIGFSEVL
KQEVNWREVVVPTAYETLFVLPRGKTLSQPSEQLLRDSTEALLKELYQHYDYVIIDSSPVLAADDTTSIAPKIDATIFVV
RLSYTSARLTKKALELLYGRQVNIPGVILNFVDTSLPEYYYYQYSEYYSTPTSVPDGEAVAPVRRQRSKPMETT
>gnl|bykdb|A0A2V6N5E0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=480 residues).
DLDQNLDRAQNKTEAASGQGSDNQGMPFSDVGPEGDYLKAKQQIQLLKAERETLAKDLRPNHPKILKLNDEITKQDKLIQ
LFRADALEKLKTRRESIGKQMENLQANIKEWEAKALDLSQRLAQFNRIKGKVDRLKTLYDRLTTNLKDIDVSQVTGSEDQ
VSIMEMATPPISVRPGLIKSLLIGFGIGALAGLAILILLDRIDDRMASFSEFQHHFSENILGQIPKEKTKGKVDLLQPDD
ARHVFAESYRNIRSSIFFMPYDGPRPKSFLVTSAVPSEGKSTLSANLAITMALSGARTLLIDCDLRRGALRETFGISSKI
GFSEVLKQEVNWREVVVPTAYETLFVLPRGKTLSQPSEHLLRESTEALLKEMYQHYDYIIIDSSPVLAADDTTSLAPKID
ATIFVVRLSYTSARLTKKALELLYGRQVNIPGVILNFVDTSLPEYYYYQYSEYYSTPTSVPDGEAVAPVRRQRPKPIETT
>gnl|bykdb|A0A2V6NH44 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=451 residues).
PFSDVGPEGDYLKAKQQVQLLKAERDTLSQDLRPKHPKIIKLNDEISKQEKLIELFRSDAFEKLETRRKSIGKQMENLQG
NIKEWEVKALDLSQRLAQFNRIKGKVDRTKLLYDRLTNDLKSVDVSQVIDTGDQISIMEPATPPVSVRPGLLKSLLLGFG
GGALVGIMILLLLDRIDDRMASYGEFQRHFSENVVGQIPKEKVKGRMALLQPDDPRHIFAESYRNIRSSLLFMPYQGPRP
KTILVTSAVPNEGKSTVSANLAIALALSGARILLIDGDLRRGALREQFGSDSRLGFSEVLQQEVPWQEVVMPTTYPSLFL
LTRGKALPQPSEHLLRDSTDQFLKEIYHQYDYIIIDSSPVLAADDTTSLAPKIDATLLVVRLSHTSARLTKKALESLYSR
QVNVPGIILNYVDTSLPEYYYYQYSEYYNRPVAPPESAAAVQHRTGQAQSS
>gnl|bykdb|A0A2V6NIJ1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=711 residues).
MNPPPVRPAAAPWSTAFFTRLYRYKSLLLRRWWILLLTICCGLFVEAWLIFQTPPSFQSTSKMMMAGKLNINQGPVYSED
NVNFYGTQIQLMQSAEVRRGAAGLVRSTNPELQPVPVELSVAQRPRTSIFELQAIGSSPDYIQAYLNAVMQKYLDFKRGM
REGQTNTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGFIQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQNLD
RGEKTESSPGASPTDQVGMPFSDVGPEGDYLKAKQQVQLLKAERDTLSLDLRPKHPKIIKLNDEISKQEKLIELFRSDAV
EKLETRRKSIGKQMENLQGNIKEWEVKALDLSQRLAQFNRIKGKVDRTKLLYDRLTNDLKSVDVSQVVDSGDQISIMEPA
TPPVSVRPGLLKSLLVGFGGGALVGIVILLLLDRIDDRMASYGEFQRHFSENVVGQIPKEKVKGTMALLQPDDPRHIFAE
SYRNIRSSILFMPYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNSRVGFAEILQ
QEVPWQEVVMPTVYPSLFLLTRGKALTQPSEHLLRDSTDQFLKEIYHQYDYIIIDSPPVLAADDTTSLAPKIDATLLVVR
LSYTSARLTKKALELLYSRQVNVPGIILNYVDTSLPEYYYYQYSEYYNRPVASSESEATTQHHPTSQAQSS
>gnl|bykdb|A0A2V6NZZ3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=707 residues).
MNAPLERPAAAPWSTAFFTRIYRYKSLLLRRWWILLLTICCGLFVEAWLIFQTPPSFQSTSKMMLAGKLNINQGPVYSED
NVNFYGTQIQLMQSAEVRRAAAALVRSTNPELQPVPVELSVAQRPRTSIFELQAIGSSPDYTQIYLNAVMQKYLDFKRGM
REGQTHTFTTGITEQLIQVEKDLRAAEDEMLDFQKQNNIGFIQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQNLD
RGEKTQTEASPNPSANDQVGMPFSDVGPEGDYLKAKQQVQLLKAERDTLSQDLRPKHPKIIKLNDEISKQEKLIDLFRSD
AVEKLETRRKSIGKQMENLQGNIKEWEVKALDLSQRLAQFNRIKGKVDRTKLLYERLTNDLKSVDVSQVIETGDQISIME
PATTPVSVRPGLLKSLLLGFGGGALVGIMVLLLLDRIDDRMASYGEFQRHFSENVVGQIPKEKVKGTMALLQPDDPRHIF
AESYRNIRSSLLFMPYEGPRPKTILVTSAVPNEGKSTVSANLAIALALSGARTLLIDGDLRRGALREQFGSNSRVGFAEV
LQQEVPWQEVVMPTAYPSLLLVTRGKTLAQPSEHLLRDSTDQFLKEIYHQFDYIIIDSSPVLAADDTTSLAPKIDATLLV
VRLSYTSARLTKKALELLYNRQVGVPGVILNCVDTSLPEYYYYQYSEYYNRPVAPSESEAIAQRSSG
>gnl|bykdb|A0A2W5YWL9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Chthoniobacterales bacterium] (length=708 residues).
MNALAERTNPGSWSTAFITRIHRYKSLLKRRWWIPLLTICLGLFVQSWLIFQTPPSFLSTSKMMLAGKLNVNSSAVYSED
NVNFYGTQIQLMQSTEVRRGAEALVRSTHPELHPVPVEINVLQRARTSIFELQAIGSSPDYTQAYLNAAMQKYLDFKRGM
RQDQTHTLTTGMTEQLIQVEKDLRAAEDEMLEFQKQNNIGFIQEEGNSAAQYLVKLNQDYARLKTEYELLEKLDLDQNLD
RGQSTAKPEASPSASASEQTGMPFSDVGPEGDYLKAKQTVQLLKAERDTLAKDLRPKHPKILKLNDEITKQEKLIQLFRS
DAVEKLETRRKSIGKQMENLLGNIKEWEAKALDLSQRLGQFNRIKGKVDRTKQLYDKMTNDLKSVDVSQVVDTGDQISIM
EAATAPISVRPGLLKSLLIGLGCGALAGFGILLLLDRIDDRMASFSEFQHHFTENVLGQIPKEKSKGKVQLLQADDPRHT
FAESYRNVRSSIFFMPYDGPRPKTLLITSAVPSEGKSTISANLAITMALSGARTLLIDGDLRRGALREQFGVSSRIGFAE
ALKQEVNWREVVVPTSCSNLSLLPRGKTVAQPSEHLLRDSTDQMLKDMYQQYDYILIDSSPVLAADDTTSLAPKIDATLF
VVRLGYTSARLTRKALELLYSRQVNVAGVILNYVDTSLPEYYYYQYSEYYNTPAEPAERPATHQVQPS
>gnl|bykdb|A0A2W6A620 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Chthoniobacterales bacterium] (length=721 residues).
MPAPAATDRPASAPWSTAFITRLHRYKSLLQRRWWIPVLTICLGLFVQSWLSYQTPPLFQSMSKMMLAGKMNISQSAVYS
EDSVNFYGTQIQLMQSAEVRRSAEALVRSTHPELQPHLVEITVTQKPRTSIFDLVAIGSTPEYTQAYLNAVMQKYVDFKK
GLRENQGSTVTTAITEQLIQVEKDLRNSEDEMLDFQKQNNIGFIQEEGNSAAQYLVRLNQQYAQLKTEYDLLSLLDLDQN
LDRTSGKNDGTTPPSTQSTDEKAPGMAFSDVGPEADYLKAKQTLQLLKAERETLSKDLRPKHPKIIKINDEITKQEKLIE
LYRQDTVEKLETRRKSIGKQMENLQTNIKEWEAKALDLSQRLAQFNRIKGKAERLKTLYDRLTNNLKDINVSQSVDSGDQ
ISIMEMAGAPISVRPGLLKSLLIGLGCGALAGIGILLLLDRIDDRMASFGEFQHQFSENVLGQIPKEKTKGRVTLLQPDD
ARHVFAESYRNIRSSIFFMPYEGPRPKTLLITSSVPNEGKSTISSNLAITMALSGARTLLIDGDLRRGALRESFGVSSKI
GFSEVLKQEVNWQEVVVPTSYPNLYLMPRGKTLGQPSEHLLRESTDQLLKEMYNHYDYILIDSSPVLAADDSTSLAPKID
ATLFVVRLSYTSARLTRKSLELLYNRQVNVPGVILNYVDTSLPEYYYYQYSEYYNTPVPVEEHDEVAATTLHPQPKQIQS
S
>gnl|bykdb|A0A317ZIW7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Coraliomargarita sp. WN38] (length=723 residues).
MSDLFNDDNQAGKVDYAEILHKSIYRTKIVLKRFWWVLPVAVSLGVAYKAIESFLEAPNYRSNAQMMLSGRISLPENELY
AEERANFFGTQIELMESSQVKSRAIERVKLTEPEVYESLEQKEEFLNEGLRSLKIAAEVKDDTSIFALSAITPDRKFSQE
FLDAVMAEYINRRSEMRAKTSEKTYDAIAAKIKSLEDEINQNEDAIVDFQRKNNIVFIQEQGSAAGTYLADLKRRLAELK
TESRTLSSISDSSEVEELILKDVPTPDDGSSDGTIVSAIGSKEDNEKYTEAKNQLDQLKADLEEFEIYLKPKHPKIIGLK
DQIERTSNQLEILRRQAFERIGERKLVIERRIDNLNDEIAIWEQSALENGRLIAEFERLQSRLERSKAAYERNQEALRAI
DTGQSLSQETVSVLEDASPAYPAGQGTVIRLAEGAAYGIVLAIGVLALISFLDNRIFSAADITNHFDEPLLGAIPFEKNH
DGDHTMVLLRKSDERYIFAEACRNLRTSVFFMGDESWKPSVFAVTSAVPSEGKSTVSANLAVALSFSHSKVLLVDADLRR
GRLHKLMNLDFDGGLTDVLEGRKEMEEVIQRSTYDNLDFVSIGGHPDHPAELLMSDSMEQFIKHAREHYDFIVFDTAPIL
ATDDTTSFAPFVDAVLFTVRCSYTHLRQIKPAIARLKERSTNVDGIILNYVDTAQPGYYYYRYSEYYTSTQKPEDSVKSV
GGV
>gnl|bykdb|A0A348NPT1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=613 residues).
ERFMAPYADALSFTGPLTPTQMLAQNRKILPQRGTLMIGVGYNHPDPVMAARVANLFADEFINYNLTLNIDGSMKAVEDL
RIRADQQKERVEELELKMAEYREDNNAVSLESQENIAATQLSSLNTIKIENKHLYDNLETRINLIESFRRAGRNLSELPF
IAEQGQVSQLLSQISAIKIGISSSSKRYREKHPVMIEQQQTLQESEVELAAAVKDSVDKLSSALVEAKSNFELASQRLAE
KELELIKLSKTRVAYSSLQREMDVQQGFLQALVQRMTQERAAVNLKNPNSRVIDEALPPLRHSSPNIVMNLAAGFFGGLA
VGAGLIFVVAFLDDRVKSAFDIEGTVGLSMLGVVPRIKKLDSNSKAQAVASNIDRHVTEAFRSIHSALKISEESKNAKVI
VTTSTVPGEGKSFISSNLALTFANHGEKTLLLDGDLRLPNVARSLQLENDFGMLDHIEKEVALDEVIMKAVYPNLDVLPS
GGKSKNPTQVLNSAKFEAMLADLRDRYDRIVIDSPPLAAVSDVLNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTP
IFGAILNNISSTLASYYYSSYSDKAYQDYYISQDVELEDELAGSVEPEMEPRA
>gnl|bykdb|A0A348NQP1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=642 residues).
MYAEERDNFIGTQIELMLSDQVQARAVERIRLLNSDLHDALMVTEAYQNDGLRALLIEADVKRDTSIFVLTAYTPHAEYT
QAYLDAVMEEYINRRVEMRSKTSARTYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNIVFIQEQGAAASTYLAELKRELAE
LNTENRVLTSILNVDAAKMSLLLDQWQGAEDTSIAASGGSDGDDQSYQYSKKQLQVLHGQLDEFSIYLQPKHPKIIGLKN
QIERTENQLEIQREQTLTRIRERQSVLNNTAANLSLEIAIWEESALDNGRLIAEFERLQSRLERSKAASVNSQDSLQAID
TNQNLQQESVSILVNARKPIPAGVGLVRRFAMGGLFGLILAAGVLFVLAAMDSRILTASELSAQFKDPLIGAIPFEASND
GDENSVLLRKNDDRYVFAEACRNLRTSVFFMGDEHEKPSVFAVTSAIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRG
RLHHLMQLNRENGFSDILDGNLTLDNAVQSTSYKHLDFVSIGGYPDHPAELLMSEYMDQFISEARERYDFVIFDTAPILA
TDDTSGFAAKVDAVLFTIRCAHTQVRQIKPAMARLRERNIEISGLILNFVDTTQPGYYYYKYSEYYTDPKNSEQSLSQQT
TA
>gnl|bykdb|A0A350ARX4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=710 residues).
MILSVWRSESLPSDPNNFSSSYDLDESSGSLDWGERLQRIYFESKRLLAIWWWIVLLAVAIGIGWQAYRELNREPVYVSY
AEMMVSGRFALPDNVYREELSNFFGTQITLMLSDRVQKQAKDRVLMLYPEITPSWVSLSVVQRSQASIFQLRAQGGSAEF
TQKFLDAVMEEYQTFRSEMRSETTETTLIAVTEQLYRLEEEIENQENTVVDFQKENNLIFLKEQDSSTGAYLARLTTQQA
ELKTQLLILENLKTGDITTSVVEQSPLIEAESVALLNKTQQEWTQLKAQLEEYSLYLKPKHPKIIDLELNIERATNLIDI
LERQTTDSLDDRKDQLRRQIQNLDAVIAQWEKQALSISRKSAEFERLQYRLDRSRNTYQRLLDSIQAIQSNQNIEQDTIG
ILAHASRAGVQPPQVGKKVAEGAAFGLAVGIVIIAAISFLDVRIRNSDELAKRFDHPVIGVIPEELQNANGQIDLLQVND
SRHRFAEACRTLRSTILLKQSDAVHTSSQSILITSATPSEGKSTISANLAIALSHLGKRVLLIDADMRRGGVHHLFSLSA
ENGLSDLLSCESDFDGYVQQTQHAKLDLIANGRSLLNSGELLLSERMDNLLEWARERYTYVIVDAPPILAVNDTIGLSNK
TDSMMFVVRASQTSTRQVQSSLERLSSRTSKIMGLVFNCAPATGVDYYYNYRHYDSYHQQPDAKQKRERS
>gnl|bykdb|A0A350AS32 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=765 residues).
MKNDYVRGAPDPNSGGYGGGYGYGGGYGYGGGYGYGGGYGAGGGYEGGSSAPQRSFKDYLLMFRERVWYLIVAFFIIFSG
SILYTFNKTKVYTAVAQVQLLRDDPSAMGNIPGMEMEPNQIRSAEDLNTQISVLESASIIVGVEQRIQDDVRERFMAPYS
DALSLSGPLSPTEVLGRNRKIMPKRMSLMINIAYTHPDPIIAADVANLFAKEFIDYNLKLNIDGSMKAVEDLRIRADQQK
ERVEELDMKLADYREQNNAVSLDSQENIAREQLASLNEMKLNAKNVYDMIETKWNLVESYRREQRDLWELSFISEQSRVA
SLLESISQAKIQISSLSKRYREKHPVMIQLLQQLQESEAELSSAVQNAVNKLDSSFSESKSNYEVASQRLAEKEQELIEL
SKTRVEYNSLLRDLDVQQSFFIALTSRMTQEKAQVNLKNPNARIVDEAFPPMKHSSPNVVMNLAAGLFGGVAVGMGLVFI
VAFLDDRVKSAFDIEGTIGLPMLGIVPRIKKLDTNSKAQAVASNVDRHVTETFRSIHSALKLNDESKNAKVIVTTSTVPG
EGKSFVSSNLALTFANHGEKTLLLDGDLRLPNVARSLQLENDFGLLDHVDKDVAIDEVIIKEVYPNLDVLPSGGKSKNPT
QVLNSAKFEAMFADLRDRYDRIVVDSPPLAAVSDALNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTPVFGAILNN
ITSTLSSYYYSHYSDKAYQDYYIHNDEEFEEELAGSVEPTVDSKS
>gnl|bykdb|A0A350QVY4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=758 residues).
MEEDFDNFSSPPVQKGKSKIKGLSDFLLIIRDRWLLAIALSLPCALFWVFYKQQEPDKFASSCSFSLTPPPAILNLQSVE
RESHLEGLISRHTEGLNSEKLRINVAHQLDNNPQYKSVLLGPFLKQGIRVGIASAYSYRITQAGSKSRPRFIITSDARSA
LGAKFVADVVQKEYEKLHKSTKSEKVEFVKQTLEDLLDTELSKEKKIAADMANYKKDNNLPFLEDEKRDTGDRKSQFSSE
VTKSRLEQIRINSLLRQILAIKTRIGSSTNSVSSKDIKDDIAVIKEFFEIDAIEQFGNIPALRQTLYDLEKTRRDYEETG
SGYLERHPRMLENARSVQQVKSALRQSVTSAIEDLRDKHIQLSAQEKEFADEMAKVQKQSEKLSEIEETLKNFERELAVV
QRSTDSIHARLNDVKIEQALPSEQDEPLRVDSVAYEPGGPYAPDKNRIREEGMMIFAVLFILIPVCLEFIDNRVKSPWDI
EVFVGNDLIGGIPKISEVEERERPLIVGNDLDDGLTEAFRSMYSRIQMNSQTDYPKLILVTSAIPSEGKSLISANLAYSC
ANHGRKTILVDFDLRRPGLHKFCNLENSKGLLSLVNDVGKPGQDVQNCISESLTEVHPNLFLLPSGGKTRAATEMLEQND
FSTVIDLLRTNAEVVIIDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIESINDTGANLLGVVLNDLPQKKTP
GYYYSGYYGYGYFRYKYYNKYYGKPDAEEKRKNKQAVS
>gnl|bykdb|A0A353DCA1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=384 residues).
MKQMVREKKDGTVDLSMRQHQYNSAKEEYEQSRMMYREMSVKQQQQRVLLKMPRTPITLHERAKKAKAPAYPNVTLNLLL
GAGVGLIFGIGIAFLLEHLDTSVKSLEDVERYLQVPVLAVIPKDVGVLHKQSGMSPDAEAYRILRTNIEFNRKNPEDNSI
TVVSGGAGEGKSTTLVNLAYVCSQGGYTTLMVDADLRRPRLHSFFDINNSVGLTNYLTTDLALEDVILQTPVDNLYFLPS
GILPADAAGILNSRRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLLRVKQAVENVGGQ
VIGVVLNNVDVRSDSQYQYYTSYYTYYAPSSLEETGTPQQMTAAPASSKTEEKKSERSSSEDLY
>gnl|bykdb|A0A353DI77 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=490 residues).
KQFINIREGVNEEGKKSDLQHLLAAAKERESELETARRRAGSYTPALEAEKEMAVAEKAVQDLSIRYGPKHPKIISATDH
IDLKTKILLSAMMDVLSNDLETDYWRGFQDQIDDVKNEENFRELRNAMKLRASLLTNSVETKNELYNTLLSRVGVLKTDA
EGVEAEVIKHEDAPRAWAPFSPNRKKIMVKTTMLGLCGGLALAFMFQFVDNKIHGVADIEQTFGISILSAIQKLPPEEEL
LKEMESIRDLPVSMKHICPTLAVPGWKTDFVHSEMFRVLRASISLLGDTNQRKITMITSSVPGEGKTFCAANLALAYAKQ
GTRTLLVDFDLRKPAVHKIFNEERAARPGIVNVLNGTAAANQAITVYPGLDTLSVIYSGPKSPNPGELLEPGRLRDLVEM
FSSNFDHIVIDSAPLLPVPDTRILAPLVDNLALVIRAEHTPVKSIQRAFDMLEDDGVFSSGVILNDFTENRLQGGKYGYG
YGYGHYGDDT
>gnl|bykdb|A0A353F286 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=680 residues).
MIPEKYESTSVVQVHPSTIAITPFRGQSAVNPGSQMTAQYLQNEFESIIAPETLAMAAEKAQLPVQWGMDMDDVVSLLEG
IVETIPRRGTDFIEINVRHASASDAKNIAESVAEAYIVRRRKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQY
GIPYFDGGSAGNRLGLSEQAMFQSAKGKLANFETQADQIKIQIGKLVQLTSEELISYAAGLDLPQNQVTAYALQNRSAVD
RMLDLEAQGIGKKHPDMVTMKQRAEGALAKAHEEVISLKEVLKTKLDLVEQQVLKMREMVDARQEDAITLSLKQTSYTQA
KEQYEQARGMLREMKFKHSEAKILLKMPRDPITLHEKPKKASKPVFPNFTMNLLLGAGVGLIFGIAIALLLEHLDTSVKS
LEDVERYLQVPVLAVIPKDVGVLHKQSGMSPDAEAYRILRTNIEFNRKNPDNNSITVVSGGAGEGKSTTLVNLAYVCAQG
GYTTLMIDADLRRPRLHTFFDINNSVGLTNYLTTDLALEDVILQTPVDNLYFMPSGILPADAAGILNSRRMSELLQDVKQ
RFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRKLPRNMLMRVKQAVENVGGQVIGVVLNNVDVRSDSQYQYYTSYYT
YYSPSNMEENQKPQAMTARKSSKSEPKGSSSSDTSNDDLY
>gnl|bykdb|A0A354FSA6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=724 residues).
MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVITSVIPEKYESTSVVQVHPSTIAITPFRGQSAVNPGSQM
TAQYLQNEFESIIAPETLAMAAEKAQLPVQWGMDMDDVVSLLEGIVETIPRRGTDFIEINVRHASASDAKNIAESVAEAY
IVRRRKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQYGIPYFDGGSAGNRLGLSEQAMFQSAKGKLANFETQA
DQIKIQIGKLVQLTSEELISYAAGLDLPQNQVTAYALQNRSAVDRMLDLEAQGIGKKHPDMVTMKQRAEGALAKAHEEVI
SLKEVLKTKLDLVEQQVLKMREMVDARQEDAITLSLKQTSYTQAKEQYEQARGMLREMKFKHSEAKILLKMPRDPITLHE
KPKKASKPVFPNFTMNLLLGAGVGLIFGIAIALLLEHLDTSVKSLEDVERYLQVPVLAVIPKDVGVLHKQSGMSPDAEAY
RILRTNIEFNRKNPDNNSITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFDINNSVGLTNYLTTDL
ALEDVILQTPVDNLYFMPSGILPADAAGILNSRRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRK
LPRNMLMRVKQAVENVGGQVIGVVLNNVDVRSDSQYQYYTSYYTYYSPSNMEENQKPQAMTARKSSKSEPKGSSSSDTSN
DDLY
>gnl|bykdb|A0A354RA24 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=758 residues).
MDDDIDSISVNAGGKPKSRIKGLSDFVLIIRDRWLLSLTVALPVALGFVYNQLQGPEYYASSSSFRLIPPPAILNLQKVE
RDQHVQGLVAKHLDGLNSQELRANVVQKIKDNPEFKSTLLAPYLKEGISMDVGATVTYSVGVSPPTEGRPRFTINSNSRS
GKGAMIVADVVQSEYEKLHKSKKSQQVESVRNVLEVLLQKSIDEESRISGEMSEYKKANQLPFLEDEKKDTADRKSQYQA
EITRCKLEQIRINSLLRQILQIQMRIGAQTSSLKSDDVEGDIAVIKEFFELDAIETYGSIPSLRKTLYDLETTRKNYQET
GTGYLERHPKMMENARQVSEIKTTLNLEVKSAIEDLRDKHIQLNAQEKEFATAMQKVQEDSRKLSEIEETLTNFDRQLAV
VRKSTDQIQSRLNDVRIEQALPSEQEEPLHKEQFAYQPFAPYTPDKNKIRKSGFIIFFAVFFALPILLEFVDNRVKSPWD
VEVFVGHDLIGGIPKISEVEERQRPLIVGNDLDDGLTESFRSMYSRIQMNSNSDYPKVLLVTSAIPSEGKSLISANLAYS
CANHGRKTILIDFDLRRPGLHNFCNITNEKGIVSLVNEVVKGSSDIDEQIKSCLHEIHPNLHVLPSGGKTRAATEMLERS
EFDYVMNKLRQIAEVIIVDSPPIGLFPDSLAIARKVEEVLFVTRYGKVSRKVAKSLLENIEETGANVLGVVLNDLPQKKT
PGYYYSGYYGYGYFRYKYYNKYYGKDKDEKPPVEKLTT
>gnl|bykdb|A0A355SVK9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=409 residues).
EVELVSAVENSVGKVDSAYAEAKTNFELASRRLAEKESELIQLSKTRVEYSSLERELNVQQGFLQALVSRLTEEKAQVTL
KNPNSRVIDEALPPMRHSSPNIPMNLAAGFLGGLAAGAGFVLLIAFLDDRVKSAFDIEGAIGLPLLGVVPQIKKLDAHSK
AQAVASNVDRHVTETFRTIHSSLRLNEESKNAKILVTTSTVPGEGKSFVSSNLALTFANHGERTLLLDADLRLPNVAKSL
QLENDYGLLNHVDKGVSLDELIIKEVYPNLDVLPTGGKSKNPTQVLNSAKFEAMLADLRERYDRIVIDSPPLGAVSDALN
LLPLVDGVIYVVKFNTVKRKTAMVNARRMAESNTPVFGAILNNISSTLSSYYYYSYSDKSYSDYYVHHDVESEQDLGKGA
LKPELQGKS
>gnl|bykdb|A0A355VK99 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia sp] (length=461 residues).
ASTLADNLKESERKQGLISVETGLPDSGIARQIEHYNEAYLEYQKIAGSAGSQNPITVSLKDRMNSTRAAANKALSNYRS
NLDLKLNQLIDKRNSLTERLTETAIKEQEIIPLIREHKVKEELYLMLLSKEQENALAMAVTESNARVLEAAHGPNLPISP
KTIKYVAGGTAGGALLSILAFMGVAMLNNKVNNKHDLPSVNRQPVIAELPQMSKKESRNTKLFIQDEHSVIAECFHILRN
NVDSMLPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDLRKSSLTRRLGGSGRKGLTSILLRQNPDT
AGVIRPVGEDTRGMDVLYTGPTVPNPVTLLSHPLLGQILSILKKQYDAVIIDAPPYGILADTAILASLSDITLYTVRSGK
IDKRYLTQIQQLADQGKLPNMAYIINGVNFKSASYSYYGYGYGYQYGYGAKDPQQTARKRD
>gnl|bykdb|A0A356FSV4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=425 residues).
MIQLLQRLQESEIELTEAVTNSTDKIYAAYIEAKRNFEVSSQRLAEKENELIQLSKTRVDYNTLYREFEVQQGFLTAIVS
RMTMQKAQINLKNPNARIVDEALPPLRHSSPNLFLNIALGAFGGVVVGLGLVFGIAFLDDRVKSAFDIEGTIGLPLIGII
PQIKKLDSTTKAQAVASNVDRHVTETFRSIHSAIRLNEESKNAKVFLTTSTVPSEGKSFVSSNLALTFANNGDKTLLLDG
DLRLPNIARSLQVSNDNGLIDYIDHDVDINAVIVNEVYPHLDVLPAGGKSKNPTQILNSAKYSSLLGSLREKYDRIVIDS
PPLAAVSDALNILPHVDGVIYVIKFNTVKRKTAVMNVRRLWESNTPVFGSVLNNVSTALSSYYYSHYSDKSYQDYYINNE
DDFEDQLVESTASGDEDTSEIARET
>gnl|bykdb|A0A357FSP9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=564 residues).
AARVANLFADEFINYNLTLNIDGSMKAVEDLRIRADQQKERVEELELKMAEYREDNNAVSLESQENIAATQLSSLNTIKI
ENKHLYDNLETRINLIESFRRAGRNLSELPFIAEQGQVSQLLSQISAIKIGISSSSKRYREKHPVMIEQQQTLQESEVEL
AAAVKDSVDKLSSALVEAKSNFELASQRLAEKELELIKLSKTRVAYSSLQREMDVQQGFLQALVQRMTQERAAVNLKNPN
SRVIDEALPPLRHSSPNIVMNLAAGFFGGLAVGAGLIFVVAFLDDRVKSAFDIEGTVGLSMLGVVPRIKKLDSNSKAQAV
ASNIDRHVTEAFRSIHSALKISEESKNAKVIVTTSTVPGEGKSFISSNLALTFANHGEKTLLLDGDLRLPNVARSLQLEN
DFGMLDHIEKEVALDEVIMKAVYPNLDVLPSGGKSKNPTQVLNSAKFEAMLADLRDRYDRIVIDSPPLAAVSDVLNLLPL
ADGVLYVIKFNTVKRKTAVVNVRRLWESNTPIFGAILNNISSTLASYYYSSYSDKAYQDYYISQDVELEDELAGSVEPEM
EPRA
>gnl|bykdb|A0A357FV58 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=720 residues).
MDDLFQDEQNTKTVDYTELFQQIVYRAKIVLRRYWWIIPLAIALGVTYKAVESFVADPFYKSTAQMIVSGRIALPENDMY
AEERDNFIGTQIELMLSDQVQARAVERIRLLNSDLHDALMVTKAYQIDGLRALSIEADVKRDTSIFVLTAYTPHAEYTQA
YLDAVMEEYINRRVEMRSKTSARTYDAIVAQLKVLEAEVDAGEDAIVEFQQRNNIVFIQEQGAAASTYLAELKRELAELN
TENRVLTSILNVDAAKMSLLLDQWQGAEDTSIAASGGSDGDDQSYQYSKKQLQVLHGQLDEFSIYLQPKHPKIIGLKNQI
ERTENQLEIQREQTLTRIRERQSVLNNTAANLSLEIAIWEESALDNGRLIAEFERLQSRLERSKAASVNSQDSLQAIDTN
QNLQQESVSILVNARKPIPAGVGLVRRFAMGGLFGLILAAGVLFVLAAMDSRILTASELSAQFKDPLIGAIPFEASNDGD
ENSVLLRKNDDRYVFAEACRNLRTSVFFMGDEHEKPSVFAVTSAIPSEGKSTVSANLAVALSFAHSKVLLVDADLRRGRL
HHLMQLNRENGFSDILDGNLTLDNAVQSTSYKHLDFVSIGGYPDHPAELLMSEYMDQFISEARERYDFVIFDTAPILATD
DTSGFAAKVDAVLFTIRCAHTQVRQIKPAMARLRERNIEISGLILNFVDTTQPGYYYYKYSEYYTDPKNSEQSLSQQTTA
>gnl|bykdb|A0A366HV03 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseimicrobium gellanilyticum] (length=748 residues).
MSAPIKKGAPGVDMLHYAVGYLKYGRMMILLLLLGVLAGVCYYTYSPAVYHSRSLIDYKFFALPVAADGVDGSSVARAVR
SVQGQLSSRQMIAWTAHSLGVGRANASFEELRSGPLRKIELGLLDGATMQLDVFSTNPNVVREFPQALINQYDSYTREKR
FEFFEVALKRYNEELGLLKKKIDESLQVKTSFERDNEINELLIKQNSLAQIPLDILRVQHRMRQYDEVRGIVQSRSQNSV
IAPLEHLSLLESAKKSSLDENPVGQLVVPASGDLKDALLVPSNSPAPLAAPSIVVQPSMVEGLNSWQMLERDKRKVETEI
AEASRVYLEDHEILKALRTKQRQIDESLTTELEVERKRFEVERLRLGDQLKELEAKLPEYSEMTEKLNKLRQDYKLGHEG
DLAWTKAYTDLSKMIATINFGGDKDRVDLQFREFALLRDVDPVSPTKSKLAILAAVLGLGLAIGVPLGLEQLNDKITSLA
ALEKLTGLKGLGIVPTSSSTFLESVTRGIESDPRKPNHVLECYRVLRAHLGLQLGNREGAKVVMFTSARPSEGKTVTAAN
LAWTLQSIGAKTLLVDLDFRKGRVHNLFGVDRYPGFCQALTGELVLEDVVRHTHLANFHYCTRGNTSAGSAELLCRLSLE
ENVAIWRQQYDWIILDTPPVLGLSETTNLQRVADAVVLVVKAEKTHGRDVTEAVEQLMRAGAPMAGFVLNNIDMSKVSNY
YYYYYSSSYYYQAFEEDDVAGRSAPVSA
>gnl|bykdb|A0A368BGT4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Puniceicoccaceae bacterium] (length=791 residues).
MKNDYVRGAPDPNSGGYGSGGYGYGSGGYGYGNGGYGYGNGGYGYGTGGYGGYGGGYGGGAGPQRSFKDYFLIFRERIWY
LLVSFFIIFSGTIMYTFNKTKVYTAVSQVQLFRDDASALGAYGQGAEMELNQILGAEDFNTQIIVFESLNIMQGVEKRLQ
DEMRERFMAPYMDTLSFSGPLTPLEVLAENRKVIPRRMSLMINLAYSHPDPLIAAEVSNLFAKEFIDYNLRLNIDGSMKA
VEDLRIRADQQKDRVEELELKLAEYREQNNAVSLQSDENIAGAQLAHLNEIVLTNKNTYDQFQTKWNQVETYRKEGRNLW
ELAFVAEQLRVSSLLQQISSTRISISSASKRYREKHPAMIELLQTLQEGELELELAVQNSVDKIYAGYSESKSNFEMASL
RLAEKERELIELGKTKIEFNSLLRDLEVQQSFFQALNLRMTTEKAQVNLKNPNARIVDEAFPPPEDQPSSPNIVLNLFAG
FFGGIAFGVGLIFSVAFLDDRVKSAFDIEGTIGLPMLGVIPRIKKLDSNAKAQAVASNVDSHVTETFRSIHSALKLNDQS
KNAKIILATSTVPGEGKSFVSSNLSLTFANHGEKTLLIDGDLRLPNVARSLQLKNDLGLLDHVEKGVSLEDIIIKDVCPN
LDVLPTGGKSKNPTQVLNSAQFEEMLAVLRDRYDRIVIDSPPLAAVSDALNLLPLVDGVIYIIKFNTVKRKTAVLNVRRL
WESNTPVFGAILNNITSSLSSYYYSNYSDKAYKNYYTNRGEELDQGEELVQGEELEDELVGDIETELESKS
>gnl|bykdb|A0A388P514 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=759 residues).
MATPEPSSDNRPPEPARGGNRGYGSYGSYGNYGAGNGGYGYGNSGAYNRGGAGEGNPIHNYLLMLRERYWWVLLSTLVFL
TLSLLNTYNTVPEYRATGRLRVFRLAPTINGGSSAADDNFKIVSNDDFFTAVEAMRSANIIEGVSKRLTADERKLVLAPY
QAGNIFSGPLTDQEVFVKQRGINPQRQTLVINVDFTHPNRDLARQVARHFCDAIKKYSEDDRLMVTNPLIEKARIEIETL
EDKVRRLYEQKNDLIKNQKLLSIAKDTNTLTTERSVLVKDREETRKQIDENEILVSVIASYEKEGRPLGDIPQIRADSDV
AATQTAISASKIRVSQMIETYTDQHPKLLAEREALKQLDNQLKEAVSQAIKSRRSSLENAKARLEAILRNLLAKEEEFSK
LQAANVELERVDKDIKASEEFLGRMKLSYEEAKLRSSTSGTSTSISILDQPSVSDKPINKNYYFNALVGVGSGLLFGVVL
IVVIGTLDSRIKSAKDVEDSLGLPLIGTVPRVANVSGPDRALLARQDKDRIATEAVRSIYSALKVNPAVSKARVFLVTST
RPSEGKTFVATNLALIFAQHSERVLIIDADLRLPNVGPSLGFTGDGGLSKWFNGEMSIEEAIVHDVSPGLDVLPVGLSCK
NPTQVINNPKFLAMIDELRGRYDRIFIDSPPIGAVSDALHLLPKIDGVLYVVRYNTVNLRNATSCLARLREAQAPLLGVV
LNAMSLRMASAYTDTYDSSYRKYYVDEPRGQSDAGSAKS
>gnl|bykdb|A0A388PDH9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=756 residues).
MAETPQKPEDNQDDSASRARGYGSYGNYGNYGGAYGGGYGAGYGQGGYGRYGVKEGGNPLYAYIAMLRERFWWLILAVLL
GVTIALVLTYQTMPEYRAIGKLRVFRMAPDVTVNNTTANNNFNITTNDDFFTAVESMRSTSIIESVSRQLTIDEKKRVIE
PYQQGNIFSGPLSEQEVFGRQRAVTPLKSTFVVAVEFTHPNRELARQVASIFCKAIQKNSEDERLTITNPLVEKLRSEID
LIEERLRKLSDKRSDLIKSQKLLSIAKDTTTLNTERGVLVRNREDARKQIDELEIIWKLILEYKKATKDVYDIAQVRTDE
RVAALGPKVTELRVLVSTMEKKYTDEHPTLIQTRAQLDQTQKELTQAVANSVNRIQASVQNARSSYDAIVANLERKDDEI
YRLQAANNELERVDKEIRGQEEFLARQKQNYEEQKLRSSTSGTSTSIKIQEMPSVADRPVNKNYYMNALTGMGLGLLVGF
GLIVLMGSFDDRVKSAKDVEMGLGLPLLGTVPKVIEAVGPDRALLARQDKDKVATEAVRSIYSAMKVSPATANSRVFLVT
STRPGEGKTFVATNLALSFAQHAERVLVIDADLRLPNVGPSLGFSGDGGVSRWFNGEMTLDEAIVRDVAPGLDVLPVGMS
CRNPTQVINNPKFLAMLDEMKTRYDRVFIDSPPIGAVSDALHLVPKVDGVIYVVRFNLVHMRNAGACLARLAETGVPILG
AVLNRMSIRMASVYTDSYDPANKKYYIDAQDSDSSS
>gnl|bykdb|A0A388PR45 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=754 residues).
MDTPSPKPGQPPEDPSRGPRGYGSYGSYGGYAGYGAPGYGNYGNYAAGGASGGKGGPFTVYLAMLRERWWWVLLSVLVFV
TIAVVYTSTIIPEYRAAGRLRVYRLTPTIGTGNTGVDETQRIGSNDDFLTAIESMKSTAVIEGVSRLLTPAERKLVLEPY
QQGNVFTGPLTEQEVFARQRGVNPTRQTFVVNVDFTHPNRELARLVAQRFCDVIQKSSEDERLTITHPLVEKARIEIESL
EDKIRRLYEKKNGLVKSGDLLDIAGTTNSIAAQRSKLIQDREDYRKQLDEIGIVVALVAQYRAAGRDLSEIPLVRSDADV
AAARAKMTDAQTRVRAMEEIYTDLHPKMIAERQALAQLSAEFQRAVKTKADSLAAAQVDLRAKLDNAVEILRQKDEAINR
LQAAAVELEKIDKDIRANEEFLGRMKLNYEEAKLRTATSGISTSIRVMDKPSVSDKPVNKNFSVNALAGLALGFFAGVGL
VLLLGTLDDRLKSVRDLEGGLGIPVLGTVPKVSETAGPDRALLARQDKDRQATEAVRAIYSAMKINPASAAGRVFLVTST
RPGEGKTFVATNLALAFAQHAERVIVVDADLRLPNVGPSLGFAGDGGVSRWFNGEMTLDEAIVKDVAPGLDVLPVGLSCR
NPTQVINHPRFGEMIDELRRRYDRVFIDSPPIGAVSDALHLIPKVDGVVYVVRFNVVSARNAAACLARLRDAGAPMLCAV
LNQMSVRLASVYTDTYDPSAGKYYVGESGAGPKA
>gnl|bykdb|A0A388QR61 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=758 residues).
MDAPAPKPGQPQDDAQRGPRGYGSYGNYGNYGGPAGGYGAGGYGAYGNYGAYGSSGAKASPFTVYLTLLRERWWWVLISI
LVFVTVAIVFTSSIVPEYRAAGRLRVYRLTPNLGNNNSAVEEAQRIGSNDDFLTAIESMKSSTVIEGVSRLLTPAERKLV
LEPYQQGNVFTGPLTEQEVFGRQRAINPTRQTFVVNVEFTHPNRELARMVAQRFCDVIQKSSEDERLTMTHPLVEKARIE
IESLEDKVRRLYEKKNGLVKSGELLDIAGTTNSIAAQRAKLIQDREEYRKQVDEVGIVVALVKQYRVAGRDLAEIPLVRA
DVEVTNTRNKVAEETAKTRAMEEIYTDLHPKMINQRQVLAQCVAEFKRSVNTKADSMQTTWLDLQAKLANSVEILRQKDE
AINKLQAAAVELEKIDKDIRANEEFLGRMKLNYEEAKLRTATSGISTSIRVMDKPSVSDKPVNKNFTFNALAGLLLGLFS
GVGLVVLMGMLDDRIKSVKDIEAGLGVQVLGTVPKVAETTGPDRALLARQDKDRLATESVRAIYSAMKINPATAAGRVFL
VTSTRPGEGKTFVATNLALTFAQHSERVIVVDADLRLPNVGPSLGFAGDGGVSRWYNGEMTLDEAIVKDVAPGLDVLPVG
MSCRNPTQVINNPKFAEMIDELRRRYDRVFIDSPPIGAVSDALHLIPKADGVVYVVRFNVVSARNAAACIGRLREAGVPM
LCAVLNQMSVRMASVYTDTYDPTAGKYYASDAGGPPSP
>gnl|bykdb|A0A3B9B9P4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=746 residues).
MDQEHPESFKNQGDTIKVRGVSDVLLILRDRWLISLCIALPIALTIAYKDLQVPEFFSSSSSFRLIPPPAIINLQKVDQQ
EQQFQLLVGKHRDGLNSQELRMQVITKIENSPELKREMLKPYVESGIPTSVGSTVSYSISLSEESRPRFTITSNARSAKS
AMIIAREVQSEYEILHRSNSSLKVESAIKTLERLLDREMKKEKDIQAKISQYKAEKEAPFLEDDKKDISAKKSQYQAEIT
RCRIERLRIESLKSQVLAVDNKIKSRKVESIEERYALFGEFFKIKEINQFGRIAFLREDLQKLYSTRKNYQEVGTGYLEK
HPKMLANGRQIRDTNMQILSEIRNAISDLYERENQLLALEDKFSIAMNDVQIEAKDVSLIDDTLRNFERELQIVQTSSAQ
MQKRLNDVTIEQAFPQEQDNPLQKEQFASLPASAYSPDKAAIQKKAATVFLAIFILFPFLLEFIDNRIKSPWDIQVFLGR
DLISGIPKISNIDEQERPLIVGNDLDDGLAESFRSMFSKIQVNSLVDFPKVILVTSAIPSEGKSLISTNLAFTCANHGKK
TILIDFDLRRPGLHKFVGLENEGGLIPIINKSAEQPNYIKENLDSELHDIHPNLKMLTSGGKTRSVTELIEKNQFHELLG
KLKSSADIIVVDSPPVGLFPDAMALSKIVDDVIFVTRYGKVARRAAKGLLSNLEESGSNILGVVLNDLPSKKSTGYYYSG
YYGYGYGYYRYKYYNKYYGGSKSNTG
>gnl|bykdb|A0A3B9FM17 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=677 residues).
ESHLEGLISRHTEGLNSEKLRINVAHQLDNNPQYKSVLLGPFLKQGVRVGIASAYSYRITQAGSKSRPRFIITSDARSAL
GAKYVADVVQKEYEKLHKSTKNEKVEFVKQTLEDLLDTSLGKEKKIAADMANYKKEHNLPFLEDEKRDTGDRKSQFSSEV
TKSRLEQIRINSLLRQILAIKTRIGSNSNSVSSKDIKDDIAVIKEFFEIDAIEQFGNIPALRQTLYDLEKTRRDYEETGS
GYLERHPKMLENARSVQQVKSALRQSVTSAIEDLRDKHIQLSAQEKEFADEMEKVQKQSEQLSEIEETLKNFERELAVVQ
RSTDSIHSRLNDVNIEQALPSEQDEPLRVDSVAYEPGGPYAPDKNRIREEGMMIFAVLFILIPVCLEFIDNRVKSPWDIE
VFVGNDLIGGIPKISEVEERERPLIVGNDLDDGLTEAFRSMYSRIQMNSQTDYPKLILVTSAIPSEGKSLISANLAYSCA
NHGRKTILVDFDLRRPGLHKFCNLENSKGLLSLVNDVGKPGQDVQNCISESLTEVHPNLFLLPSGGKTRAATEMLEQNDF
STVIDLLRRNAEVIIIDSPPIGLFPDSLAIARKVDEVLFVTRYGKVSRKIVKTLIESINDTGANLLGVVLNDLPQKKTPG
YYYSGYYGYGYFRYKYYNKYYGKSDAEEKRKKKQAVS
>gnl|bykdb|A0A3B9GA54 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=724 residues).
MQGSNQTNFDSTPSIDYWQILKNRYGVILLTFLLVFITAAVITSVIPEKYESTSVVQVHPSTIAITPFRGQSAVNPGSQM
TAQYLQNEFESIIAPETLAMAAEKAQLPVQWGMDMDAVVSLLEGIVETIPRRGTDFIEINVRHASASDAKNIAESVAEAY
IVRRRKIEEDRAKKALDALDAESTEQEDLVDDYRKDLTVLIQQYGIPYFDGGSAGNRLGLSEQAMFQSAKGKLANFETQA
DQIKIQIGKLVQLTSEELISYAAGLDLPQNQVTAYALQNRSAVDRMLDLEAQGIGKKHPDMVTMKQRADGALEKAHEEVI
SLKEVLKTKLDLVEQQVLKMREMVDARQEDAITLSLKQTSYTQAKEQYEQARGMLREMKFKHSEAKILLKMPRDPITLHE
KPKKASKPVFPNFTMNLLLGAGVGLIFGIAIALLLEHLDTSVKSLEDVERYLQVPVLAVIPKDVGVLHKQSGMSPDAEAY
RILRTNIEFNRKNPENNSITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFDINNSVGLTNYLTTDV
ALEDVILQTPVDNLYFMPSGILPADAAGILNSRRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRK
LPRNMLMRVKQAVENVGGQVIGVVLNNVDVRSDSQYQYYTSYYTYYSPSNMEENQKPQAMTARKSSKSEPKSSSVSDTSN
DDLY
>gnl|bykdb|A0A3B9LCP2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Spartobacteria bacterium] (length=715 residues).
MQASAAERSTPASWSTAFITRLHRYKALLLRRWWIPVFTVCLGLFVQAWLIYQTPPSFLSTSKMMLAGKLNIAQGAVYSE
DSVNFYGTQIQLMQSAEVKRSAEALVRSTHPEMQPVPVDITVSQKPRTSIFDLQAIGRTPDYTQAYLNAAMQKYLDFKKG
MREGQGQTVITGITEQLIQTEKDLRTAEDEMLEFQKQNNIGFIQEEGNSAAAYLVKLNREYAGLKTEHDLLSLLDLDQNL
DRAQIKPESLANGQTAEDQGLPFAGVGPEGDYLKAKQQLQLLKAERDTLAKDLRPKHPKIVKLNDEISKQEKLIDLFRAD
TVEKLETRRKSIGKQMENLRANIKEWEAKALDLSQRLALFNRVKGKVDRLKTLYDRLTNNLKEVDVSQVVDSGDQVGIMD
MATPPISVRPGLIKSLLIGLGCGLLAGIGILILLDRIDDRMASFGEFQRQFSENVLGQIPKDKTKGEVTLLQPDDARHVF
AESYRNIRSSIFFMPYEGPRPKTLLVTSAVPNEGKSTIAANLAITMALSGAPTLLIDADLRRGALREAFGISSEIGFSEV
LKQEVNWQEVVVPTFYPSLFVLPRGKISAQPSEHLLRDSTDAILKEMYNYYDYIIIDSPPVLAADDTTSFAPKIDATLFV
VRLSHTSARLARKGLELLYDRQVNVPGIILNFVDTSLPEYYYYQYSEYYNAPASAPEGETVAAPHREQAKPVETS
>gnl|bykdb|A0A3C0R669 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Spartobacteria bacterium] (length=715 residues).
MQASAAERSTPASWSTAFITRLHRYKALLLRRWWIPVFTVCLGLFVQAWLIYQTPPSFLSTSKMMLAGKLNIAQGAVYSE
DSVNFYGTQIQLMQSAEVKRSAEALVRSTHPEMQPVPVDITVSQKPRTSIFDLQAIGRTPDYTQAYLNAAMQKYLDFKKG
MREGQGQTVITGITEQLIQTEKDLRTAEDEMLEFQKQNNIGFIQEEGNSAAAYLVKLNREYAGLKTEHDLLSLLDLDQNL
DRAQIKPESLANGQTAEDQGLPFAGVGPEGDYLKAKQQLQLLKAERDTLAKDLRPKHPKIVKLNDEISKQEKLIDLFRAD
TVEKLETRRKSIGKQMENLRANIKEWEAKALDLSQRLALFNRVKGKVDRLKTLYDRLTNNLKEVDVSQVVDSGDQVGIMD
MATPPISVRPGLIKSLLIGLGCGLLAGIGILILLDRIDDRMASFGEFQRQFSENVLGQIPKDKTKGEVTLLQPDDARHVF
AESYRNIRSSIFFMPYEGPRPKTLLVTSAVPNEGKSTIAANLAITMALSGAPTLLIDADLRRGALREAFGISSKIGFSEV
LKQEVNWQEVVVPTFYPSLFVLPRGKISAQPSEHLLRDSTDAILKEMYNYYDYIIIDSPPVLAADDTTSFAPKIDATLFV
VRLSHTSARLARKGLELLYDRQVNVPGIILNFVDTSLPEYYYYQYSEYYNAPASAPEGETVAAPHREQAKHVQTS
>gnl|bykdb|A0A3C1AXQ2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=438 residues).
VNSGRGREHPEVEGVDSQILLSKQLILDAVKSHLSALQTRMDFAIKRRASLQNSNEDAKKGMLDQQSAQNDYKTAADEVA
YIESLLLQLKSTYFQTKAELELVKSPATIYAIATPEGKPAKPNVALNLALGGVLGLMLGVGLAFFLEYMDTSVKSLDDVE
RFLGVPVLAVIPKDVAVLHRASGFNPDAEAYRILRTNIEFNRRNPDANCITVTSGGAGEGKSTTLCNLAFVCAQGGYSVL
LIDADLRRPRMHTLFDVSNSVGLTNFLTTNVQLEEVVVRTPVENLYFLPSGMLPADSAGVLNSQRMSELIADAKSRFDLV
LIDSPPILGVSDASVLANEADLTLIVVQHRKLPRHMLMRVKQTVENVGGTVLGVVLNNVDLRSDSQYQYYTSYYTYYSPD
NMAAPADKKPERRKKPTPAGQPSPGAAASSNAPRGDLF
>gnl|bykdb|A0A3C1C1M3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=737 residues).
MTQPNFPPSNLPPASGQPPGAPIYYGGGDPYSGGMPMDSGPLQSLNPMRLLQIARNHWVILLLAILFAGGAAAFYLSRAT
EIYQAEARIELSTRRPRIVNKQDAMIEDRGYGDAEEILNTQIQKFNSPSILPFVVASYRELYPDDPAPEEELTARLANRG
RFAIIKRTRLVSVTFTDPDPEFAMRACAAYAAGAEAAARAENRSGSNAAVAWLEAQALAQRQELEKADQELFDARQTLQM
DVLAGRRKTIEESLLHFNESLSEVEAKASMEQKMLDALSEGKLPAEIPGAADVAASLDRWRQAMTERDALLSRYTPEHPA
VEAQDKAVALYKEQANQALNRAKNTAAANLALYQEQAGSLQKKNEELLETASKLDRDILEGEMRITALNRTRSAADASYL
GLLTRIQEARLSADENTATVKLASEVAPARQIFPRPARVLLMALLLGLAVGFGLAILTEILEDRVGGIDDIEIGTGVKIL
AVLPHVKTRKRKEIATTSLTHQFGELAEAFAGLRSVLDSPLYRDHSQIVLVASSLPEEGKTTTSCNLATACALNGQKTLL
IDFDLRRPRVGNIFPRPEAVCGLLEYLDSDQMKPEEIVYASECRNLSVISSRVVGRSRPAELVGGAKVAALLAWARAHFD
RIVLDVPPLGIVSDALSLAHLSDCVLVMARPATSRKRAVRHTIQRFQAAGMANLAVVMNDVEHSKFTYHSYGPYYHYQKH
YGAYAQAVPPSLTPTGK
>gnl|bykdb|A0A3C1UJT2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=498 residues).
DLEDLESVGYVDAASEKARPDNLTNEQLEIVSLIPSVAKNEDFKSINGLYKAAKTTVRNLEVDLKSKHPLMIDALRNVNN
TRRVLLETISDVPKGLYAQIKYQQEFIEELTQSIENQTSKLFEWEQLYMQQAALEQDLEIGTKLIDNIKDQIQSIEFTAE
SEGTTIELAEKATEPSTIEPNKTQRIILGVLLGLGLAYGYLYLMNMMDQSIKSVEQAEKILQLPVLAAVPVSEINGKPTD
SRLVMIESPNSTCSEAFRSLRVNIESMTRKKSHKVVLFTSSIPSEGKTFTSINYASSLAQQGHRTLLVDMDLRKPAVGPE
FKLGEEYVGVSDLLQSEDKLGQFPDLAIYEATEKLFVLHGGSHISNPSEHISGSAIEELILKARQNFDRIVIDSAPLGPI
GDTLSVARLADMLCLVVRSGKTTSKVVLRIIDYLHRHGHTPSGIVLNFLRNNNNKGSYYYYYSSDKDKTYSKSGYQKKQV
TNSPMEVGASAEDEPVKS
>gnl|bykdb|A0A3C1VFY9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia subdivision 3 bacterium] (length=713 residues).
MKEDSALTAPDRHAWGRKFFSRVQRYRNLLLRRWWVLVVCLVLALGIEAVHIQFTPPEFISVGQMIVSIKVNIQQGSLYT
EELGNFLGTQAALMQGNEVLNRARERVASQNPGVTPKPVALQVSVLPKTTIFILRATGGNPEYTKAYLQACMDEYRNLKK
GMTEHASDTTVAGLTDQMLRLDPEMRKVDDQVAVFLSTNDVAFLEEASGVANYLSVLYQRLAESKSEYDLLQSMTLDQNL
LLEQGRSPALAGAGMPGGLGTGNGILANAALGGQSTLFAPSTMGMQYLSIKQQILLLKAEQDRFGEFLKPKHPKMVAMNE
ESEKMGRLLGIYRDQSVEQLEAKKSALALQIKNLENQTKQWGRQNIELGHKSAEYASLKAKSQRLQALYDQLLATFQTLN
VNKDASPETVTIYQPASDAFPDTTLLKKGLMFAGLLGLGLGLAILILMDRVDDRMSSFTELEELFDEDVLGNVPREKSPD
KNTVLPLLQPDDLRHPFVESYRNLRSSLLYMAETGTRPHTLLITSAVPNDGKSVTAANLAITLATGGSRVLLVDGDLRKG
SLHSRFKIQADTGLSESLAQGMDWHKAVKETTVGNLFLLPRGASTQHSSELFLGPVMGKFLQETIKEYDYVLIDTAPVMA
ADDVTSLAPRVDGVIFVVRAEFTSARVVRASLDMLYQRKARVLGLVFNAVRMSVGGYYNYYRYQDYYSTHPGK
>gnl|bykdb|A0A3D0IZR7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia subdivision 6 bacterium] (length=404 residues).
MRGQLRADRSDRLAPYNEARRDFETQSQLLEVLMSRYRQQSVESRIETRPVQVVNRAEPAVRPVKPSLKLNLALSMVVGL
ILGLSLAFFIEYLDTSIKTMDDVERFLGISVLAVIPKGAKFLTSDDPNSRFAEGYRILCAKLNLTGARASARTITVLSGG
PGEGKSTTTFNLGWVCAQSGMKVLLIDGDIRRPNMHNALQIENTLGLGEYLAGQASLDELIQSTAIPNLEILTAGSLGPE
ELGGFSRSRLATLMEACRPNYDVILVDSPPVLGISDASVISQEVDVSLLLIQHRRYPRNVSQRAKRVIEDVGGKLFGVIL
NNVNIKTDDNYYYYAGYSTQYGYKKRAPRAAQRSKATATVAAVEIPAATPAASVDEVVEHPLDTPEASAPKVTFIRPPRG
QDRF
>gnl|bykdb|A0A3D3DET9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia subdivision 3 bacterium] (length=431 residues).
MLLRVEQQELGRYLRPNHPKMIAMQEDIARREELLKILRTQSEEQLKNRKELLAVEIEILEKDLKAWDARNQEFQHKNAE
YQALKANVQRIRALYDQLLATMQTLDVNKEISPESVETIEAASPAYAARLDLWKGAVNGALLGLALGLGLLLVLDRLDDR
VGSFTELQDLFDENVLGQVPREKLVASKRQPSLILPEDTRHSFVEAYRNLRSSLLYMTEAGNRPKTILVTSSVPNDGKSI
TAANLAITMANAGSRVLLVDADLRKGTLHRLFGVSPEPGLSDVLAKGTAWETTVSATKIANLHILPAGTFTARSSELFIS
EATQRFLRDAASRYDYVIFDTVPVMAADDVTCLAPQIDGVIFVLRAAFTSARVARASLESLYQRQVRLLGLVFNAVRPSS
EDYYYYRYKDYYRPYPSGGTKAAESVRTEQT
>gnl|bykdb|A0A3D3LEQ6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=764 residues).
MNPRQSSNSQKGKLDSSKLIRLLLQFEDYWRLMALLFALGLLSGAGYFVYARATFESTALIRINQFVDAAKAASGAQRDN
NIALMRSLSKQLTSDFYQLEAAKKLGVATASTTAVDLRASLIPAIRIGFLDQNHIQLRVISYRPRIVREFPQAMIEAYEG
ARKRLRNEYRDKAIARYVDELADVRAKVTSQLDSRLKFEEESALASAQIELERLSDVPVQQVRVRYKLQEMDGVRQVLKD
QGGTLDTVGTLALLTSMTSDKDDPLSVGRIVRRTGDPRTSAPATFQTPEMAKEYNQIVVQPDMVEGIEPWRELDKKKRSL
EEKMAQSRAKFLDDHPEMIKLREELRETVSALELELQVARRAFDLEYEKLKEQLVELEAKLPDYYKAAKSYDEKKLAYEL
MEKGQLAWDKAYEQLSRQIEGLEFGSDESAVSLEFRGFTDIRSEAPVSPNKSKLLMLGCLLGLGMAGGVPFLLKQMDSTV
TDLNEFEETLGIPGIGLVPLTDPEVLEEVNRSQTVGSKVPNALLENFRLIRSSILLNRSPMGEARVIMLTSARPGEGKTT
VSANVAWAFSSMGEKTLLIDCDLRRGRVHNVAGVPNLPGLTRLLTGQATLEECLVKSPAENLWLLPRGQVIAGTTELLNT
EVFSQLLDTLRKQFSRIILDTPPVLGLSETAFLQNHADGVVLVVRSASTPRSDVTAAFQQLEKLGGHFFGFVLNRVDFSK
RSNHYDYYYYSSNYYDSNWEEEKEEREADERPGRKKRRGSSQSA
>gnl|bykdb|A0A3D3LGD3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=670 residues).
MKIERLQDKVQVFERSSDNFMANSDVVVKNEFESIIKPETLYPVVDKLDLQLKWELPTRQAALGKLRSNLDTQSSIRSDF
VIIEFFDKDPALAATIANAVADSYMTRRVEVESKQKESALEMLNKQITEQEQLRAQAQLKMQEAKTKAGIVGEWFSAGPN
STVPGAELRTTGDSMAVTREQAIFQADLDVETLSAEIGQLQTLEGDELVARAGGLKLDNANVAQMTGELQRLEVAREGLV
NQGRGRRHPEVLANDSQITKYKELIAAAAKDHLAGLQNRLESARKRKEALEASNQDAKSELLGQQSAFNEYKTAKDDVTD
IEAILRTLKTRYFETKAGLEIFKSPATIYAKAEPEGRPAKPNVALNLALGGILGLMFGFGLAFALEFMDTSIKSLDDVER
FLGVPVLAVVPKNVGILHRATGFNPDAEAYRILRTNIEFNRKNRDANCITVTSGGAGEGKSTTLCNLAVVCAQGGYSVLL
IDADLRRPSMHTHFDAGNTTGLTNFLTTNVRMEDVVVRTAVENLYFLPSGLLPADSAGILNSQRMSDLIEDAKSRFDIVL
IDSPPILGVSDASVLANEADLTMIVVQHRRLPRQTLMRVKQTVENVGGTVLGVVLNNVDLRADSQYQYYTNYYTYYSPDN
RPAAEGGKPKKRRKAAGETAPARTPGGDLF
>gnl|bykdb|A0A3D3NW23 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=765 residues).
MNPRQSSKSQKGKLDSSKLIRLLLQFEDYWRLMALLFALGLLSGAGYFVYARATFESTALIRINQFVDAAKAASGAQRDN
NIALMRSLSKQLTSDFYQLEAAKKLGVATASTTAVDLRASLIPAIRIGFLDQSHIQLRVISYRPRIVREFPQAMIEAYEG
ARKRLRNEYRDKAIARYVDELADVRAKVTSQLDSRLKFEEESALASAQIELERLSDVPVQQVRVRYKLQEMDGVRQVLKD
QGGTLDTVGTLALLTSMTSDKDDPLSVGRIVRRTGDPRTSAPATFQTPEMAKEYNQIVVQPDMVEGIEPWRELDKKKRSL
EEKMAQSRAKFLDDHPEMIKLREELRETVSALELELQVARRAFDLEYEKLKEQLVELEAKLPDYYKAAKSYDEKKLAYEL
MEKGQLAWDKAYEQLSRQIEGLEFGSDESAVSLEFRGFTDIRSEAPVSPNKSKLLMLGCLLGLGMAGGVPFLLKQMDSTV
TDLNEFEETLGIPGIGLVPLTDPEVLEEVNRSQTVGSKVPNALLENFRLIRSSILLNRSPMGEARVIMLTSARPGEGKTT
VSANVAWAFSSMGEKTLLIDCDLRRGRVHNVAGVPNLPGLTRLLTGQATLEECLVKSPAENLWLLPRGQVIAGTTELLNT
EVFSQLLDSLRKQFSRIILDTPPVLGLSETAFLQNHADGVVLVVRSASTPRSDVTAAFQQLEKLGGHFFGFVLNRVDFSK
RSNHYDYYYYSSNYYDSNWEEEEKEDREADERPGRKKRRGSSQAA
>gnl|bykdb|A0A3D3NZQ6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=723 residues).
MSEASPDLQNHALDSWRVIRGRAGLIILSFLLVFGSAAMLTYIMPRKYRGRVEMKIERLQDKVQVFERSSDNFMANSDVV
VKNEFESITKPETLYPVVDKLDLQLKWELPTRQAALGKLRSNLDTQSSIRSDFVIIEFFDKDPALAATIANAVADSYMTR
RVEVESKQKESALEMLNKQITEQEQLRAQAQLKMQEAKTKAGIVGEWFSAGPNSTVPGAELRTTGDSMAVTREQAIFQAD
LDVETLSAEIGQLQTLEGDELVARAGGLKLDNANVAQMTGELQRLEVAREGLVNQGRGRRHPEVLANDSQITKYKELIAA
AAKDHLAGLQNRLESARKRKEALEASNQDAKSELLGQQSAFNEYKTAKDDVTDIEAILRTLKTRYFETKAGLEIFKSPAT
IYAKAEPEGRPAKPNVALNLALGGILGLMFGFGLAFALEFMDTSIKSLDDVERFLGVPVLAVVPKNVGILHRATGFNPDA
EAYRILRTNIEFNRKNRDANCITVTSGGAGEGKSTTLCNLAVVCAQGGYSVLLIDADLRRPSMHTHFDAGNTTGLTNFLT
TNVRMEDVVVRTAVENLYFLPSGLLPADSAGILNSQRMSDLIEDAKSRFDIVLIDSPPILGVSDASVLANEADLTMIVVQ
HRRLPRQTLMRVKQTVENVGGTVLGVVLNNVDLRADSQYQYYTNYYTYYSPDNRPAAEGGKPKKRRKAAGETAPARTPGG
DLF
>gnl|bykdb|A0A3D4CZT6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=311 residues).
LSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIPTDVGVLHKQSGMSPDAEAYRILRTNIEFNRNNPED
NSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFFDINNSVGLSNYLTTDLMLEDVILQTPVDNLYF
LPSGILPADAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMIVVQHRKLPRNMLVRVKQAVENV
GGHVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSADSDPVPTVGATASATSGSALESKVVANDSEEDEGLTY
>gnl|bykdb|A0A3D4HHL8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=725 residues).
MTAPPTKSPRYDDVEPKIEWSELIHVWLFRAKLLLKRFWWVFLITISLGVAFQTYDVLITPPSYVSYSQMIVSGRIALPE
GAIYSEELSNFFGTQMSLMQSHRVKERARLRVRAMQPELDPCVVRVSVSQSPDASIFILSAVGEKPEYTQAYLNALMNEY
LSFKREMRSETADRTFLAITEEMMDLQKEIESGEDEKLNFQKENNIVFIQEQGSSVGAYLAELNQQLAELETQYRFLDTL
SLDAIGERAQAVAELAKAKRKNNTEVVPAENHSGAALTSELYKLSEQYLVAKKELNLLKAQRDEYLTYMKGKHPKLAAVN
LEIERKENEMSVLKRQALHELKDEKEVLQSKISHLKDVIDEQEVKALDYSRRLAEFERINSRLDRQKSLLENLTASIQSI
DINLNLDQEFLTILENASPAYAVRISIVKNLVMGVVAGVFMGVGILFIISILDSRIISVEDVENRFDQPLMGIIPFQKYD
GDILNPIKADDDRIIFAEACRNLRSSVLFGGDENEAHQVVAVTSSVPGEGKSTMAANLAVTLAFAGKKTLLLDADLRRGV
LHNAFNVPNDKGLSDVIRERISFDDAIQRPGIENLDFVAHGTTTKRPGELLSGVYFATMLEGLRKRYDFIVFDLPPVLAT
DDTPGFVQKVDGVLFVVRSNTTRVKQAKSAFHILMFRRAKILGIVLNAFDVRGPGYYYHRYGEYYTRREEPSPKVSKKMQ
AVSKT
>gnl|bykdb|A0A3E1E5C8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=718 residues).
MPDHTARPFPPAHDKEEPAVERRSLRDYYIILREKLWIALPLALLVSLSLGYYEASRPKMYAATATMQFEKADTVVTTQG
VVDPSVRSELELRSNLEKLNSQRLRTKVVESFTPDEVKILQRPYLKNLPPGAGVPSAGEALGAVSIDSTRNSLLISITVR
HPDPVAAALVANQYVNQFVGYLMDYYGGKNETGVEYLRAQADRLGKDAADAEQKLMAYKKEHNLVSLGNSTNIVGTRLTT
VNDALTKARLARIDLETQYHQVEAYRKEGRNLMEIAYIAGHATVPTLKNQLSNLHQNQSVLGERYLERHPKMVDLANQVT
VVQDQLEKAVDLAVADLATQLSEARQSEANLQTEYDRAEKESLHLGDLSVEYNSLENQANVAKSNYVQILNRLNETTTTR
NLEKIPLHPLDAAVVPGGPYEPDLARIIRTCLGVGLLVFFAAGLGLAFLDDRIKSAWDVESYIGANLLGIIPDLSAVTDD
DKYSLLLKGPQTPGAEAFLSVYSSVKIHSKLDFPKSILITSTIPGEGKTLIACNLAGSFARHGKRTLLIDCDLRRPMLHR
NFKQENLHGLITWFEGGAKLDGDLSTDPSLGIIKLADNLSLLCSGGRAKSPTELLENPAFGQLLEKLKKDYDLVVVDSPP
LGAVTDSLLIAERTDEVIYVCRFNCAAKKHVRLYMKTLRNGKNEVLGVVLNGLSPRRIEYYSNYRYYRSYKKYYGTQS
>gnl|bykdb|A0A3E1EF48 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=658 residues).
MATKTFADYLNWLKRYAWIAVLTTITGTFYGFYLFTITPKTYQSWTSIQIARVKQEAADVAEEERIRLGVPAELQATLEK
LRMPRIYQNVASNPLFANRPEVVPLSRRYVLPWEPFLAKKPNPEEKPAPGTKQGPAAGDLAGMMAGWVSVSVRENTNLVD
IFAAHTNPEVARDVLSCLLTEYEKLTAESIAGSEENTINYIVEKCRELQEGIFKIESSLARYQGCVDLSKRIETTRIAII
EMEKRYLPKWPDLIEAKELLALLLNRFSTELAQVIAGSAEEQRFWKENASVLAGLEGEALIAAQLRTVASRASILSKALE
TEQGIFENLNTKLKEADVTRGIATRQFEIIQPPTLPGGPIAPSMNDIVGRFSGGGFLLGIACIFLIGFLDPSIRTVGELE
RDARLPVIGAVPSSSSKGDGTKRELVLLSRKDPHASEAIRTLRTGLTLLGDSEERRIFVVTSSLPGEGKSWISANLACGF
AQQGERTVLIDADLRKGVLHSTFNLSREAPGVTNLLSRTSSLAEVIHQTEIENLWFVPGGGKSANPAELLGGRHLGTFLA
DLCRDFDRVVIDTAPLVPVSDTLPIAKRAQSVIMVYRMGKTPRKALFRGLKTLRSNHAEPVGIVANLLPRVAGRGAYGYY
YGYHGGGAIDGYVSNDSK
>gnl|bykdb|A0A3R5R793 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=408 residues).
MIGLRSSLKSKLEMVAASRKHWEATVAQKEEDLQKHVLQVPMYEQASRDYDAALDQLKELDSRYKDEIARLRVPREVIEM
YQLPTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSDAMGPDAE
AYRILRTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNEVGLTSYLLE
DYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDMTLMVVQP
RKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSADGSSSGENADASSMKKVERSGKAKELAATQ
SHDSEDLY
>gnl|bykdb|A0A3R7RBR8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutales bacterium TMED207] (length=792 residues).
MKNDYTGDQSNMNSNHYGGYSNNYGNPQYYNHGSYRYGGNSGSGSYGYGSYGNVSEEQGPQRTFKDYIFLIRERIWYLII
VFFIIFLGSILYTFNKTKLYTAYATIELLRDDPTVMNSASNLEQNEIRSSEDLNTHISRLESVSIIQGVEKRFQEDELAQ
FMAPYKGTFSFSGPLTAFEILSINRKIIPRRMSLMVNIAYTHPNPIMAAKIANLFGDEYINTMLSQNIDASMKAVEDLRK
RAEQKKNRVEELELKLAEYRELKKAVSLDKQENIAAEQLASLNEIKTMAKMNLDQAEIRWNLTQDYQKQGKELWELPFIS
EQIRVATLIEQISAIRIAISTKSKRYREKHPEMRSLLQQLQESQSELEYAVQNAVDNISGYFAESRDNFKQASKRLLEKE
REMIELSKTRVEFNSLIRDLEVEQMTYQKLTALMAEEKIQVNIKNANARIIDKAFPPREDRPSSPNVFLNLAGGFFGGMI
FGLGLVFAVALLDDKVKSVYDIEASLGLPILGIIPKVKKLDSVSKSHIVTSTTNRHVTENFRSMLSYLKINDQTKNSNVF
LLTSTVPSEGKSFISSNLALSFASNGEKVLLLDGDLRLPNVAKSLQLENESGVLDYIQGEGTFDSYIAKEVYPNLDILAS
GGKAKNPTAILNDSKFESMLLQLRDRYDKIIIDSPPLAAVSDSLNIVPLVDAVIYVIKYDSVKKSLANSCIRRLWESKTP
LLGAVLNNVSLGLSHYYYSQYSANKKYSAYYMQESYLGNMDESEAEESNQAIVADTFTETKTDSDSEDKLDS
>gnl|bykdb|A0A3R8L982 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium TAV4] (length=756 residues).
MPDTTNNRPPPSAKLHSGDDDLVERRTLRDYYIIVRERLWIALPLALLAALGYAYYKSRELPMYQSTATMQIEKPERVVT
SQEVVDTAVSSDADLNTYLQIIGSQKLRDKVAESLKPDDIKILQRPYQQDAIASGSPLPGPSGLVGGINVQSVARSYLIS
ITAYNRDPDGAALIANRYVDQFITYLIDSVSGRNEDAVSYLNTSADRLRDEANAAEQRLLDYMRRENLVSLDNSTNIVRE
RLTSVNAALQTARLERLAIENLNNQVEAFRKDNKDLIELNIISTYGTVPALRAQLAEHLRTQAVLSERYLDRHPRMIEID
NSIRVTRQQLAAAIALAIADLQATLEKARAREASLAIEYTANEKEHLRLRDLSVEYKSLENTAAVAKSNYAQILDRLSQV
NTSRNLEKLPVRRLDRALPAGAPYSPNPRSITQTSVALGLLVFFGVAFGLNLIDDRIKSAWDVEHFIGANLLGIIPSLGD
IKDHDRYKLFAVGPNAADESGGGNNNSEGAPDRRRDPERDPHTNDGQGEHATEAFLSIFSAVKIHSRLDFPKSILVTSTI
PGEGKTLISCNLAGAFARHGRRTLLIDCDLRRPTIHRHFGIENNAGLLAWFEAGAPFDDLLPENPHLGVIKIGENFDLLR
SGGRSRTPTEFLESAAFTQLLTKLKKHYDLVIVDSPPLGAVSDSLLIAERTDEVLYVCRFNRALRKHIKLYIKALRAGKN
EILGVVLNGLTARRIEYYSNYRYYRSYKKYYGPRAA
>gnl|bykdb|A0A410ELH5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=638 residues).
MLSHYNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESSLLEMS
LTASNPQKAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEFKTKSDIVKDTDTTMSADFST
SQALEKEIFDLETQIKLAAILADNLKETERKQGLISVETGLPDSGIARQIEHYNEAYLEYQKIAGSAGSQNPITVSLRDR
MNSTRAAANKALSNYRSNLNLKLNQLISKRDSLTERLTETASREQEIIPLIREHKVKEELYLMLLSKEQENALAMAVTES
SARVLETAHGPNFPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESRNTGLF
IQDEHSVIAECFHILRNNVDSMLPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLGG
SGRKGLTSILLQQSSDTTGIIRPLRENSRGMDILYTGPMVPNPVTLLSHPLLGQILGILKKQYDAVIIDAPPYGILADTA
ILASLSDITLYAVRSGKIDKRYLLQIQQLADQGKLPNMAYIINGVNFKSSSYSYYGYGYGYQYGYGSGEPRQTTRKQD
>gnl|bykdb|A0A424R295 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Coraliomargarita sp. TMED73] (length=758 residues).
MKNDYIKGGGDPNSGGYGYGYGYSGGSGYSYGNYGYGGYGGGGEQAPQRSIKDYILIFRERIWWLIVSFFIIFSGXLLYT
FNKTKVYTSVAVVRLLRDDPSAMGVSVELAQNQIVGAEDLNTQISLLQSGKIIQGVNRRMSDEQRKRFLLPYEGAFSFSG
PLTPTEILGKYRKIMPQRMSLMVNVAYTXPDAQIAADVANLFAQEFINYNLSENIDASMVAVEGLRIRADQQKERVEEIE
LKLAEYRERHNAVSLDSQENIAREQLVTLNQIKLESKNNYDQLDTKWNLIETYKREERKLWQLTFVAEQSRVSRLLESIS
ATRIEISSYSKRYREKHPIMIQLLQTLQESEIELQEAVTNSVDKLYASYIEAKSNFELSSKRLAEKESELIALSKTRVEY
NTLLRDLDVQQSFFQALNSRMTQEKAQVSLKEANARVVDDAFPPLRHSSPNITVNLLVGVFGGLAVGGGLVFIVAFLDDR
VKSAFDIEGTIGLPLLGVIPRIKKLDSSTKAQAVAANVDRHVTETFRSIHSSLKLNDESKNAKVILATSTVPSEGKSFVS
SNMALTFANHGERTLLLDADLRLPNIASSLQLPNEFGLLDHIEQGSRLDDMIVSEVYPNLDVLPSGGKSKNPTQVLVSAQ
FEAMLADLRDRYDRIVVDSPPLAAVSDALNLLPFVDGIVYVIKFNTVKRKTAVANVRRLWESNTPVFGAILNNITTSLSS
YYYSQYTDKAYQDYYIGQEDEMEDELAASTEPEEKVES
>gnl|bykdb|A0A432FAS4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=325 residues).
DLATAQMAPIKPKKMLTLFLGIVGGLGAGFGLAFFVNFLDDSIKSQDDVESYLKLPFLGYIPNIKTTSVIERDLQSHLHP
QSNSAESFRTIRAAISLSQRAGDLQVMAVTSTIPAEGKSLVASNHAIVMAQTGAKTLLVDFDLRRPSVHKAFQLQSPRGL
SSYLLGKIDSIEEIVHHAEVPNLDVICCGAVPNNPSELAGSQRMKDFIEEIRSKYDKIMFDCPPVSAVSDPLMIAAATDG
IIFVSKFNKVRREHARKTVQRIQDAGIYIAGICINDLDFEGKDSYYYSYYYYQNRYYASHYKSDKPGGKDEETNSKKPEK
ESSAA
>gnl|bykdb|A0A432FDF6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=441 residues).
TLANHGIDLGEEHPRIKGLKKVVATLEGQIDNRIKGILAGLGLRVNSSQAQVEQLQRDVDAAKKRESDMRKTGREYFDAK
RELSNTTRIRDTILFRIMQEEVDLALPKESTVEITDDADLPIKAVRPNIPLNIALGVVVGLVLGVGLAFFIEYLDTSVKT
IDDVERALNAAVLGVIPQNVGSLLDEGDESPHAEAYRVLRTNILFAGRQSEKQTTFSVVSGGAGEGKTTTMFNLAVVFAQ
QGDRVLVVDSDLRRPSMHRFFKLSNKIGLTNYLLGQATIEEVIQTTELPSLHFIPSGKLPSSSMGILSSAKMKEFVAEMK
SRYDYVFLDAPPIMGVSDASVLASMVDMCVLVVQYRKYPQLMTQRAKDMVTKVGGELVGVVLNNINISQDSYYYYYSGYY
YDYYYKSREKEESADEAQDGKKDAKLLAKADIGGEDEKPKY
>gnl|bykdb|B1ZT68 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutus terrae] (length=722 residues).
MPTSKKPAADRRNPQANTGFRITPRDLLQMFQERWLLGLFLGAIAAGVFVYFQPEKVPLYYSEVSLLFETRKDRVLNIQD
VVDTGVRSTTELNVHAEQLRSQTFFEYVLTSFNKEEAERIQRPYRDPTQPDKPVPSLAEIIRPNLTIFARRNTTILVVGV
TNRNPENAALIANRFARRYIDYNLDRANSGTNSAIIFLRNQAEELRAQVEAVESSLQEFRARNNIAALGENQNVVLQKVG
TVGTALVRAQMEQVEMRSVLDKIDEYRKEGKDLFEIPAILGYGQVSALRTRYAELQAQRKLLGEKYLRLHPKMTQNELET
TETKRLLDEAAAQAIANLETRNRIAAQHEIRLRAELEQAERSAHELDKTSVDYKFLEQDAATKRATYSRIVDRLNEASVA
SQMENTNIKIFDPAYVPGGPIGDALAILIAKASFIGVGLFVLIPLGMGLMDTRIKTVSHVEDALGEVLLGAVKTIDGLGE
IERAHVYRLHKDDGLTESYRGIYSAIDIHSTEPFPKAIISTSSMPGDGKSLTASNLAAAFAAHGRRTLLVDCDLRRPVLH
RYFGVDLSNGWIRALATSAAGGQPPPLPTTIAFSENLDLLPSGGVAKNPTETLERFVTSGMLKRLLERYDLVILDTPPVA
VFPDALLLSRYCKELIFVCKYGSVRLNSVRKTLARVHETGIKVLGLVINQMPESRFRASGYEGYGAYGQDYYQAYAKTSA
AQ
>gnl|bykdb|B1ZZ74 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutus terrae] (length=720 residues).
MSLAEAKPAVQPGGARDEETLVERRGLRDYYIILRERLWIALPLALLVAVPLGYFRARETPLYAAMATMQFEKPETVVTS
QVVVDPSVRSDIELNTNIQVLNSARMRSRVVESFTPEEVQILQRPYLANLAPGASPPSAGGALGGVSIDAARNSLLITVR
VVHPDPEAAALVANRYVNQFMTYLIERVGGVNESAVEFLRNRADQLRKEAEQADVKLNAYMQAHNLVSLDKNKDIVSERL
KTISSTLTSAQLVRLNFENQYALVEAYRKEGRNLVEIQFIAGHGTVPTLSAQLSSLLQSQSVLAERYLERHPKMIDLANS
IAIVQEQLGKALDLAIADLGTRLNEARENERTLQEQFAKAEKESLDLGALAPEFNSLQNQAQVSKANYLSILDRLNQTTT
TKNLEKIPLHPLDHAVVPGAPFTPNLNAIIRLCVGVGVMVFFGVAFGLSFIDDRIKSAWDVESFIGASLLGIIPDLAALK
DDEKYSLLLSGKQAPGVEAFLSVYSSVKIHSKLDFPKTVLVTSTIPGEGKTLISCNLAGSFARHGKNTLLIDCDLRRPML
HRHYKQQNNAGLITWFEAGSPLDGELASTPALGIIKISENLSLLCSGGRSKSPTEFLENPVFGQLLERLKREYDLVIIDS
PPLGAVTDSMLIAERTDEIIYVCRFNRAYRKHIRLYMKALRDAKNEVLGVVLNGLSPRRIEYYSNYRYYRSYKKYYGSQS
>gnl|bykdb|B4CZV9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Chthoniobacter flavus Ellin428] (length=722 residues).
MIPGTKKPAFTLHDIFLYVAIASKHARLMVLLICFALTAGLTYYVFAKPVYYAHALIHLEYLARPLDTDKLYEDGRLSAF
VAQFTEPQIMLRTARALGIDTNSRDLERKYLFKFRASLNTEKNIDVEAWPYSADWAHRWTETMVQQFIAYRQERRNEEKN
LIVNTYSEELKELVGRLDQQFSEKLDFQDQQDFTKTLILVNSINNLPADLTKLQMRIDEIGRVRVRLQDPALDSVAKLSL
IASADDNDTRLSVGQTVAQPQSGQSADKKDAAANNSVVVVPSLLKSLHPWDELAQQQQQVKKEISEGLRKYLPTAGAMKP
LYQQLDVINQRLDAEVEVATNRFNLEYQELLNKKHDLEAKLPEYQELSRKHAKLLSQLSIFDASRVPYDTYLANMQREIN
EVEFAGEKERINLKYSGLLEVRDDPVSPNRLRIMLLSFVGGLVLALGIPFLIEYLDHTMTNLEEVEHSFRLRGLGVVPQT
EATDMFLPATAVASDDTTKHGLVENFRVIRTNILSMGELSKPPHVVMVTSAMPKEGKTVVSSNLAASFALTGAKTLLIDT
DLRRGRLHRLFGYRKEPGLSNVLLGECTLEDAFRPSGQENLTVLSAGRHLDHGTELLGSAQFSELLNSLRGRFDRIVIDT
PPVLGLSETSIMQSLVDGVLFVIWTGQTPVRCVKSAIETLRANRANFYGFVLNRLDLNATQNYYQYYYYSHDYYYQHAIE
ST
>gnl|bykdb|B4D1I7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Chthoniobacter flavus Ellin428] (length=699 residues).
MDAHPAATPARDQDAASWWYLIHTKIYRYRALLRKYWWMVLFTTCAGMAIGAWMLAHQQVVYVSTGRIMASGKINLPEGV
TYTEEMNLFISTQRELMQDEAVRQRAANLVRSNNPELTPCPITLFVAPLPQTSIFNLSAIGTEPQYPQKFLDALMHEYIA
TRREMRTEKSEDAESSIEDEISRVQADVRKEEEKLVTFQRENNVGFLEQGGNSAGAYLAKLNTQLAEFKKEAQLLDLFQL
DQKIAADESRAGDKDGERNPRLTGQPEMEYTHARQQIEVLKSERAEYAKDLRSKHPIMVELDRQIAQQQQLIDAFRKQSA
EDLQHRREATRLEIENLEKTIKEWEAKALDLSQRLAEYGSLQANVTRARAQLESLSRSKGNVEINRNVDQDIISIRQRAS
AATPQKPGAVKTVGTGIGLGLFVGLLLLVLIDQLDDRVASYTEFQSYFRERVFAQIPHSPSDGRSESPAILMPEDERHAF
AEAFRSLRSSIAFLPVAGAPPKVILITSAVPNEGKSTVAVNFAITLALAGSRVLLVDGDLRRGELHRSFGLTNDAGFGDV
LSGRKSLDDAIQLTLVPGLMLLSRGRGVPNPGELYLGRSADEFLKTVHAEFDYVVLDSSPVMAADDTTSLAPKADAAVFV
FRFTSSSTRASRKALELLRERQTNVIGIVCNDVSEAMQDYYYYRYPDYYATAKSDQAGV
>gnl|bykdb|B5JIS2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiae bacterium DG1235] (length=808 residues).
MAHSETKKSLRPHASAGYGASGSRNSNTEDTLAGVVTQIRSFFAIIRSRWLSGVVSALVVGSAFAYLFLNDKPEHTAVST
MLAQSPLDELLHSDQQARERKKDAQENFLQNHLSVMKSRRFSVELASEFTEDEKASIVRAFVKGDGVPSMSAFEKILAGR
MDATRQRDREFFTLSFRHPEAEIALMVADRMTAAYLKLVQREIKETNQAAAEMLRLQAEQLQAEISELEGKQRDFRERNN
VISLEENQDLLAERLKGIDANRIEARLDRFRLETKLGNVKAALGEDGRPFDNPFLANFANNERLRQELDKLNGQREVMAL
RYGRNHPKMRDLDSRIEAVEGNLNRNMEMALKDLEGQYTNVVSLEKRLDDDFRKKFTESIEVGRLADQFLVIGSEVDAKR
EALTSLLRRVSNANVVSNLPVDVMRVVDPAFIAKPKLAKRKLVAAFTVLLAGGAFFGVPLGMQLFDQRLKCATDIEKEFG
KGLLGGIPKLSRVKVADRPHVVRDNLDLAKVESFMAVVAQLELTSKQEGPKSFVVTSTTTSEGKSTIAANVASGFVQIKR
KTIIIDGDLRRPCLHQFNRIKKSGGLIRWAEEGYPMDDIYGEDSPLGIQKLKGGAYLLPAGGVFPLPSKLLVSTKIDALL
RKLEETFEVIIVDTPPVGLYPDALIFAKSVGETLLVARESKAPISQIRQVIGDIDSTGAPVLGLVLNDYSFGSLNPRLAY
GGKGKYKYHNNIKKHAKGAGRVKSKSMVGKLMAEDVEDDDNLEAVEANGKVAETAKSKLKSTPLKLNNKNSGSKSLIGKL
MSEQEKKE
>gnl|bykdb|D5EML0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Coraliomargarita akajimensis] (length=736 residues).
MGKDDFTIEANASTTSVFGLTDLLAVVRKHWMSGAFIGLVVAGLFVASVLTKEKLYQASASMTVELTTANVMDIREVMDT
NVAHVNLLNTLMNTHLERIKTRAIADAVVAALSEDQIQQLVDPYYDPAIDGENKPDPAVLLMRRMLSVERGENEESQVLN
IIITHQNPRIAQQVANTYVDEYIAYKAGLRSSSTGEAVNFLERQVAEMREELELQEVELQDYRQQHNLVSVQQDKGITAD
RLARLNDALTDAEIRQLSVETRQRQIAAADGVIDRLMEIPYIGERDAVNAVYAQLSELKRERLVLDERYLRKHPKIVENE
AAMKSVSTELSRAIRQAEQQSTIEYQTVQKEVSDLTARIQETEGRVLVAERSLLEYKRMERDVDQKREMFNKLMNRYRET
RIAQQMNLNNMLVLDRANLPMQPLTMSRTQMVAAAIVLGAVFLVGCPLVIELIDGRLTSFQDVEQGSHKALLGDVRFYGQ
KKGDAVYQAVLQKDADLLESFRSIYSSIRMRADLSAKRKASFVITSSVPNEGKSMVACNLSAVIAKHNYRVLLVDCDLRN
PSLHRAHGVEDDAGLCPWFDSGSTDMEDLLGNESLGILKLSPSLSLLRAGGGCEHPTELLGDLRVSALFSKLKDLYDIVV
FDTPPIGLFSDATIVADSADSCVMVARQFAVKRTKFQHSVNQMERSTAPVVGVVFNGIKDVNAAVGFGRNGVSHYGYGYE
KDPEKYKAYYRRSRSA
>gnl|bykdb|R7E1V8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia sp. CAG:344] (length=662 residues).
MVASSNVTANYIPMQYSVLTSTEVLKVVSRKLNLAAEWGMTDEMAASNLAGMIKVAPVRATDLVDVIVSGPDPKLVQNIA
KTVPEAYKQDREMRENRLVETAIKSLKDVLREQEDTVNEKMMSLKKLIAESSYLPTTWRNGENRSTLTAGMEEEDFRNAK
SQAMQFEKDEKELASYVQELQRLPDDKLLDYVISSDLLNAESVGAKALRETYAEFSDKLKEKENLKAQNIGARHPKMLAL
LETERILGEKLNKELIGLRSSLKSKLEMVSASRKHWEATVAQKEEALQKHVLQVPMYEQASRDYDAALDQLKDLDSRYKD
EIARLRVPREAIEMYQLPTYPAAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNV
PILHSSDVMGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYY
ELDNEVGLTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAV
IVSEVDMTLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSADGGSSGENADASSMKK
AERSGKAKELAATQSHDSEDLY
>gnl|bykdb|R7E4L8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia sp. CAG:344] (length=778 residues).
MPVSVIQPEDNDIFSFRFIFSTARRYWPWILACALLGGGLAYFICARQGYLYQKTARIMLRDDKQKNAQVSEIILSDLGF
KPGEANLANESYVVKSSEVMSRVVKGLGLDVSYWEKRNIREVDLYHTTPLKAEFSEEVAFQPCSLAVTPLNGREFSLSYR
AKESGENVLHGKFGVPLKLPFATVNVCPTSYFSSGSMGRTIFVERVSVKEATDGMLGRLSVTRPDSKESSLLELTLRLSH
PQKAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRIGKLGGQLGGVDKQVIDYKRNSRIVKDMDTTLDATFNRVQEIG
TELFSTRTELIQVKVLARLLADRSRQQDMIPANIGIQDAGIAKQIELFNDNFLQHKKLFASAGRQNPMVSSLAENMKEMR
ESIGRSIANYCNALEVRMGELEKERNELNRLLSDMASKDEGLVPLLREQKVMEELYLMLLKKREENALALATTEPSARIL
EPAFGSNAPVAPRLSLMTMGGMAGGAFASLLALLAGNALNTKVRDKKDLAGLTDLPLAGELPLLSGKERKKLPLVVTNGR
SFMEECFHILRNNAELMLLPNPEEAPRILFLTSTRAGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFYGGKNAR
GLVHLLMNPQVSPDSVLQSGKRFPGFDLVTAGPVPPNPVALLTQGRLEELLRYWRARYDRIILDGCPYEAVADASLMARH
ADLVLYVIRCGMIEKQYVPVIQGLADKGEFRSGAVILNAENFKNSRFHYYDEYSETDG
>gnl|bykdb|W0J7C2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium TAV5] (length=722 residues).
MTTTDTTAGNRPSPGRPRAASIRRTPRDFLDMFAERWWIGALAGAAAAALIVVFRPHFEPIYRTEVSLLFEARKDRVLNI
QEVVDTTLQTAAELNTHIEQLRSKTFADYVLASFSTAEAELIRKAYADPLDPDAAPPPLDAIIRPNVTVFARRGTPILGI
QVSNRSPEAAALIANRHARKYIDYNLDNASTRTNSAIVFLRNQADETRAQVEAAEKALQNYREKNNLAAIGETQNVVLQK
MSSLGTAVVAATLDQIDAKSLIDKIEEYQAGNRDLLEITQIRTSGQVADLNNSLISLLTQRTLLAEHYLGEHPKMKQNEA
ETRETRRMLAESIAKAVADLRARYDVSAHYLQRLQAETTGSEAQARELDKISIDYKFLEQDANAKRATYARIMDRLTEAG
ITSRMANTNIAIFDPAWVPDAPSDTGALEIAVKAGAAGLGLLFVLPLGIGLLDSRLRTPAQVEDSLQEPLLGVVKHMGKL
GETERARIFLSHASHDLSEAYRGIFSEIEVRSPLAFPKALLVTSSVPAEGKSLLCCNLAAVFASHKRRTLLVDCDLRRPT
LHRLFGVKPDTGWVDWLETDPAQRPTLPVGIVPVADHLDLLPAGRSLGRPTELLDQLSRRETLQPLLDNYDLILFDTPPA
AVFPDALMLARCCHEMIYVCRYRTVRPAIIRKVIDRFHGTGISLLGVVLNRLPQSKARSYGYHGYGTQSAAYYKAYEEQT
PA
>gnl|bykdb|W0J900 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium TAV5] (length=752 residues).
MAEIPFTKTGPDTGPLHPRPSAPRSEPPFEGGSLPRLDIRQILLCIRERWIVSTSLATLVCVLLGVWLLKQPKVFQASAT
LLVGRIEKVLGNEITNVVDDSVGGSKNDPAFDTHLAQITSREMIQRVVASFKPEEKARILAPWLDKDAPPLSDSQTDARL
ASLIADNVGVVRQGSTFLVRVSYKHREPAVAALVATRFTECYIVYLMDRNTSSNDSAISFLREQTEDLRKKAEASERALQ
AYREKTRMVSLEESQNIVVDRMKAISSALTEAQVARFAINARLQQAESIISKNSDPLELASVTEFSSLASVQSQLDGLIA
KKAVMSEKYGRRHPAMVEQERSIQALEKLRGDLVRAALSTLRNQREKAVENERQLQEKLADAEKASLGLDRLAVEYNVLR
REAETNRATYTQVLGRLNETSLTAQLGNSNIKISERAQIPTFPIEPDPKKIFRALGFLGLLIIIGYPVGMELIFNRVKTW
TDVERYIGLPLLSEFPVLKKLPDDKLNHLVLQDTDPDAGEIIQTLYSQLRLNSRLDAPKTLIVTSTVPGEGKSFVASNLA
TAFAAHGMRTLIIDGDLRRPVQHRLAGAPNTHGLLRWLDKGGRSDGPLAGDPDLGLLRPAPNLFVLRAGGISRRISELLE
SKKLKALIEQAQREFDILLIDTPPAGIFPDALSLAPFANELIYVVRFNYVSRPQVHRVTERLRSTGLELPGIVLNMMPSG
RGSSGYYSGYGYYGSRYYASYYKEEQLAGQSG
© 1998-2019