BYKdb

Dataset for cluster tadcd of phylum verrucomicrobia

[Download (right click)] [Alignment] [Repertoires]

194 sequence(s)

>gnl|bykdb|A0A0R2XQ77 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium BACL24 MAG-120322-bin51] (length=754 residues).
MKNDYVRGAPDPNSGGYSGYGGYGSNSYSDGGYGAGGYGAGGAPQRSFKDYFLMFRERVWYLIVAFFIIFSGSILYTFNK
TKVYTAVATVQLLRDDPSAMASAEMEMNQIRSSEDLNTQISVLNSGAIVQGVERRLQDDERERFMAPYADVLSFTGPLSP
AALLAQNRRIMPQRGTLMIGVGYNHPDPVIAARVANLFADEFINYNLTLNIDGSMKAVEDLRIRADQQKERVEELELKMA
EYREDNNAVSLDSQENIAGTQLSTLNTIKLENKNVYDNLETRMGLVETFRREGRNLWELSFIAEESRVAGLLDRISGVKI
GISSSSKRYREKHPVMIEQLQILQESEVELVTAVKDSINKLSSAFAESKNNFELASQRLAEKEAELIELSKTRVEYSSLE
REMDVQQGFLQALVGRMTQERAAVNLKNPNSRVIDQAFPPLRHSSPNIAMNLAAGFFGGLAVGAGLIFAVAFLDDRVKSV
FDIEGTIGLSMLGVVPRIKKLDSSSKAQAVASNIDRHVTESFRSIHSALRLSDESRHAKVLVTTSTVPGEGKSFISSNLA
LTFANHGEKTLLLDGDLRLPNVARSLQLQNDFGLLDHIEKGVALDEVILKEVYPNLDVLPSGGKSKNPTQVLNSARFEAM
IADLRDRYDRIVIDSPPLAAVSDVLNLLPLADGVLYVIKFNTVKRKTAVVNVRRLWESNTPIFGAILNNISSTLASYYYS
SYSDKAYQDYYISQDVELEDELAGSVEPEMEPRS
>gnl|bykdb|A0A139SPN4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Cephaloticoccus primus] (length=727 residues).
MPAGQSRSLRDYYVILRERFWIALPLALLVALGIGYYQARQTPMYASTAIIQFERPETIVTTQGVVDASIRNEIDLNTYI
HQLTSNRVRTRVLESLTPEEIAIIQRPYLKSQPPGEPLPPLAAMLGLLSIDPVRNSFILRLTVGHQDPEAAAILAQRHVD
QFLSYLLDNISGVNDTALDFLHERAEQLRLESEAKAQKQQEYMEKNNLISLDSSTSIVDNRLLTINGALTAARLRLLEVE
SIAKQVADYQESGDNLLEITYIGSYGTVAPLRTQLSTLLQEQARLAERYLERHPRMIETTNAIITTQEHLDFAVQGAIAD
LHASLTEVNKTISQLETEYTAAEQEALNLRNMRVDFESLQNEALVARSNYMQILDRLNQTTTTKYLEKVPIRLLDRAQVA
SHPYTPNFPKIIRVCVMMFLVVFFGTAFGLDFIDDRIKSAWDIENFLNTSLLGIVPDLNNVKDEDKYTLLLKDTNPTAVE
AFTGIYSAAKTHSLVDYPKAMLVTSTIPGEGKTLVSANLAASFARHGKRTLLVDCDLRRPMLHRRFDLANTSGLIPFYES
GASLDTDLSTDPTLGIVKLNENLSLLRSGGRSRRPTELLESDLFGDLLKKLGRYYDLIVIDSPPLGAVTDGLLIAERVDE
VAYVCRFNRAHRKHIQLYMRALRNAKTEILGVILNGLAPRRVEYYSNYRYYRSYGKYTNVEPARGELDREPARAPEAAPA
AEPAVAA
>gnl|bykdb|A0A139SU05 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Cephaloticoccus capnophilus] (length=749 residues).
MAEPAGSSPTPPVPLGAAPSSSAADAPVEQRRSLRDYYVILRERFWIALPLALLVSLVIGYYQARQTPMYASTAIIQFER
PETVVTTQTVMDATIRNELDLNTYIHQLTSNRVRTRVLESLTPEEVAIIQRPYLKSQAPGEPLPPLAAMLGLLSIDPVRN
SFILRLTVGHQDPEAAAILAQRHVDQFLSYLLENISGVNDTAVDFLRERAEQLRLESEAKAQRQQEYMQRHNLISLDNST
SIVDSRLLAVNGSLTQARLRLLEVESLAKQVDDYQEAGANLLEITYIGNYNTVAPLRGQMTTLLQEQARLAERYLERHPR
MIEVTNAIIITQEHLDLAVQGAIADLKTSLIEVKKTIAQLENEYAENEKEALSLRNMRVDFESLQNEAAVARANYMQILD
RLNQTTTTKYLEKVPIRLLDRAQVSGRPYTPNFPKIVRMCVMMFCVVFFGTAFGLDFIDDRIKSAWDIENFLGTSLLGIV
PDLASVKDEDKYTLLLKDTHPTAVEAFMGIYGAAKTHSLVDYPKSMLVTSTIPGEGKTLVSANLAASFARHGKRTLLVDC
DLRRPMLHRRFDLANTSGIIAFYEADGDLDCDLPNDSTLGIVKLSENLSLLRSGGRSRRPTELLESPFFGDLLQKLGHYY
DLIIIDSPPLGAVTDGLLIAERVDEVAYVCRFNRAHRKHIQLYMRALRNAKTEVLGVVLNGLTPRRVEYYSNYRYYRSYG
KYTERVDRPERETKRPKKVVEEAEVSEIA
>gnl|bykdb|A0A139TLN4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia sp. KLE1798] (length=794 residues).
MKSSSPKPDSLETEGGASVSLFPSPRALLARIIRNWYWCLLSLCICLPLAYLYAARLPFVYGKATTVLIKNDYPKESVAT
TVLATSNGIVNTASTNLDNEIFLLSSYSLMEEVVRKLKLDVTYWKKSGFRKEEIYDRSPIAVHFSERGNPAEAGFRVIPV
SDTEFRLESGVNDSRPERETGVFGREIEFCSHTFTVEKTPRFDSRSLDAPVIVRKTFIKNAAIALIGGLTVNKASGKTNL
INISVRCNNPVKAENVLHNLVRFYNEASLDEKKKRGMNTDKFIEERLGVINEEMGENDLAIENLKKESNILTDLSTALTE
EYENSLNDKKDLRELTLEIKSIEYLKEYLEKEAEFDSRLVPINSKIADMGIRDQIGVFNDTLLKKTSLKVNAGDNNPIVR
ELEANLASLKDALKRSVNNYYTSLLVKKKNVEEQHEGTRAHIRAVSGKERAVNQIAREQRVRESLYIFLLNKREENSLAL
AATEDNARIVDAVRGGDGPLAPNVPKILLVGFLVGLAVPVLGCVIAAMMDSRVKRREEIESLTDIPVYGVLPRKPRKLKN
QEIVVNLEEPSELSESFPLLAERLVSLADENGPGGFSILLTSSCPGEGKTYLAVNLALSLAVAGKKVLLMDMDLRKGTLS
SLLGGEGKPGTGDLDRVGEGGWRSLLEKSSVSDHLDYLFAGTLPDHPSRLLLHDRVRELMKELKEHYDFIFMDCVPYASL
ADARIAARLADATLYVMRAGCVKKRDLSSLQKTWKSGELKRMGIVLCDVENRSRPSRKYAMYRSFDTSSPCPGK
>gnl|bykdb|A0A139TS01 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia sp. KLE1798] (length=736 residues).
MNAPDQQNGDPIVRNIDYIQVLKNRWKEVFLVFMLVLVISLVVTLLMPPSFRATSKFQIKRPRPVMGIGTGEDVVASSNI
TDNYIPMQYSVLTSSEVLKVVSKKLNLAAEWGMTDDLAATNLAGMIKVSPLRATDLVDVIVSGPDPKLVQNIAKAVPEAY
KQDREMRENRLVETAIKSLQDVLREQEDIVNDKMMALKKLIVENDYLPSTMYRSGDNRSVMTGAMEDEDFRNSKAQLMKF
EKDEQELAAYVAEVQRLPDDKLMDYVTNSDLLNAEILAADSLRKTYQEYMEKDKERENLKAQNLGPKHPKMVALQETANI
LKEKLNKELVGLRSSLRSKLEMVTASRVKWAKIVAQKEEDLRKHVMKMPVYEQTSREYDTALDQLKTLDARYKDEIARLR
VPRESVEMYDNPLLPTAPYKPDVTLNLAVGAVAGLLLGMGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSA
GSLGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNEA
GLTSYLLEDYPLEEVIFQTPVENLYVMPAGPVPFDPSGALNSRKFSELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVD
MTLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSAESGASGGNADASSLKKAERSGK
AKELAATQSNDNEDLY
>gnl|bykdb|A0A139TUL1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia sp. KLE1798] (length=780 residues).
MSIPVIQPEDNDIFSFRFIFSTARRYWLWILAAALLGGAGAYFIFARQGYLYEKTARIMLRDDKQKNSQVSEIILSDLGV
RAGEANLANESYVVQSSEVMGRVVKGLELGVSYWEKRNIRKVELYHTTPLKVEFGEEVDFQPCSLAVTPLNGREFSLSYR
EKGGRETALAGKFGIPLELPFATVTVRTTSHFSSGSIGRPIFVERLSVKEACAQMLGRLSVTRPDSKESSLLELTLRLSH
PQKAEDVLNYLIEVYNDHSRREKQIASTRAEDFIVKRIEKLGGQLGGVDKQVIDYKRHSRIVKDMSTTLEATFSKLQEIG
TELFSTRTELIQVKVLAGLLAEGGRERDMIPANIGIQDAGIAKQIELFNDNFLQYKKLSASAGKQNPMVSSLAENMKEMR
ESIVRSISNYCDVLRVRMGELERERDELNRGLSDMASKDEGLVPLLREQKVMEELYLMLLKKREENALALATTEPSARIL
EPAFGSNSPVAPKLPLMTLGGMAGGAFLCLLSLMVSNALNTNVKDKNDLVGLVSLPLAGELPLLSGKERKKLPLVVINSR
SFMEECFHILRNNTELLLLPNPEKASRVVFLTSTRTGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFCVGKNSR
GLAHLLMNPLASPDSVLQSGENFPGFDMVPAGPVPPNPAALLTQGRFEDLIRYWRTRYDRIIVDGCPYEAVADASLMARH
ADLVLYLIRCGMIEKQYVPSIQEVAARGEFRSVALILNAENFKNSRFHYYSEYSGSETAG
>gnl|bykdb|A0A139TV24 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia sp. KLE1798] (length=789 residues).
MPQPTVPPVSSPAPETPDSSLSLDIVAIILRRRWYWILFCALLGGTAAYYMAATQNYVFEKTASVMMREASKDSSTDRIM
VELGVDSGAANLANESFILRSSTVMRHTVEDLKLNVSYWKKRDLRQIDLYRESPVEVIFENIPSDRSCSFDITLKGDSAL
SLTYQGSDGKPVQLEEELKKPVHLPFATITVYPTSHMPETIPGTTITVRRVPINAAADQLLANFTVKRPDAKESSLLQMT
LTSSNPDKATDTLNKLIEIYNEHSREERRAIAVKTKEFIRRQLEQIGEELKRLDSERDDIKFENDIIADTQASLSADFST
AQTLDNSIFELQTQIMLANDLENNLKAVSKKAELISLDTGIADSGVSRQIEAYNTAYLEYQKIAGSAGSQNPIVVSLTKK
MDATRAAAFRSLSNLRDNLNLRLQELTRKREDITRRLAATSGKARKLTPLNREHGVKEEYYLTLLTKEQENELALETTPS
SARVLETAHGSNAPIAPNTRKFVLGGAAGGAALCLFAFMGVAILNNKVKNRHDLDAITTLPVIAELPAMSKKEQKQVSLM
LPDEHSVMAEYFHIMCHNVDSMLPFSEHQGHVILLASTTPGEGKTFISANLAQAFSKIGKRVLLIDGDLRKTSLSSQLGG
KGRKGLSTILLNKVSDLSSVIHPLPDHPGVDILYGGPHVPNPVSLLSRPEIEQLIQSFKRSYDAVIIDAPPYGILADTAI
FAKLADISLYVIRSNKIDKRYIATIQQLANEGKLPNMGFVINAVDFKAAGHHYYGYGYHYNYGYNTTNS
>gnl|bykdb|A0A146G2Q9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Terrimicrobium sacchariphilum] (length=718 residues).
MSLESPDSGEIKLHFLDYWRVIRVRLPLIILVLLLVVITAGVVTYFMPKQYASTVTMQIRQNDKVLQVFGQGGVQGLDPR
FLATQFEIIQRKEILYPVIDALGLDRKWGMPSREQAYFRLVRMINIQEIRNTELIHITVFSTDNKEAMEIANRIAEEYQK
RRLSEENEFLGKSLAQLQQEVEKQQAIVTKLQETMTRIRQETGIQDLNPDTADGGTQAENSILLQVEQQVSQESLRVAAL
RAKYDQVSKMTDEQIMRSLTTLEIEDPTITQLYPQFQEAASEEARMLNAGLGANHPNVKALRAKKEVMQRQLAEQTAILR
KTLETNLAIAEQGLKSLQDKLDKVRSDWQTSKTSSIGYYEAKNNWLQARKVLEAAQTRLATEKMEQTIPQSPTTIWESAE
ISLVPAKPNVVLNMVLGVIVGLVFGVGLAFFIEYLDTSVKTMEDVESFLKVPVLAVIPKGISLLVNEAKDNADAEAYRIL
RTNIEFNRKNPDANTITMISGGAGEGKSTTMSNLASIFASGGYSTLIVDADLRRPSQHRIFGVENEVGLTDFLTTDVHLE
EVVNQTKIDNLFLMTSGRLPADAVGILNSQRMVDLIEEVKHRFDIVFFDSPPILGVSDASVLSSAVDLTIIVVQHRRFPR
AMLQRVKQAVLNVGGNILGVVLNNVDVRHDQHYQYYTSYYNYYYQKPQQQKADKKPAKKAPVSAVQQLNGEKDQEDTY
>gnl|bykdb|A0A146GCJ0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Terrimicrobium sacchariphilum] (length=765 residues).
MPKDDGENLTSKPAVNLSFRDDTHGDLFDSERWFNLLRSKAWLIAAVAVVVVIGAAAYAFRLPKIYESRALLQVEQLAQK
VVDIADVSQENPQSTDFLKTVVEALKSRKLLARVVKAEGLDKDPDFAPPRKDGSPYSEIELVDKLAQKIDVQLIRGTRLV
QIVVEDKNPEKAQKIAATFVKEFFRENFDQKLALSRVANEFLQDEADKLKVKLEASERKLQAYREDNKAVSLEERQNIIV
EKLRELNSKVTEAKSKRLQLEADIDQLKRVEKGNLDALLAINSVSNLPQVALIREQLLNAEGDLAGLKERYLPKHPKYIA
ASMRIANLRQSLATEATQASETLSRLYEAAKDSEVKLEAALQEQEAKALELNKVAIPYNVLQRDVESDRALYESVTKRLK
ETAITQGIEQAPYRVIEEPMVPNVPSKPRIKLILLVSLVAGLGLGVALVVVIDLLDASLRTVDEAESYLGLPALTAVPEQ
RSKSVGEQVAEAWNDKTLGSLPKDLAQKQVLEPLRRSLNRKEREAQLKKHPLIFVEDPSSMQAEAIRTLRTSISLLGKQD
DRKTFLFASAIPQEGKSFTSLNFAHALAQKGLRTVVIDADLRRPRLKDDLLPDAGDIDGLTDYLSGGAPLDQVVRKTDQD
NLFLLPAGHRAPNPSELLGGSEFREMLAKLLLTYDRVVVDSAPVNAVSDALLIASCVDTACLVVRAGKTPKKASLRAVKQ
LQKSGAKLAGFIFNRLPVGGRSAGYYYYYYGGEYSKNSVYGEKSV
>gnl|bykdb|A0A178IH18 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium TSB47] (length=723 residues).
MARPDSSSETAALPEFFQVLRQRKFLILLVMALVVGTAAVVTALLPKWYLSTINIRVEKPEGKVVFENQANNYYDPYFLQ
DQFKVIQSPKILNPVIENLGLNRRIAALLGASAPYPTDVTYEYLTKKMLRVEMPRNTSLLEVNVFSRDAALAAAIANEIA
RAYSEDRIAFATAEQRAGLDQLRRELAGQERAVATQRDLVEKLRAQLNISGVNLVTPQGGDIEIETLRQMQNTLVALRVD
AIGRRARYENFKKIPEADRANLVNSELITDTNIQNLLQAYLVADQNVTRLRSRLGEAHPELITATDNRAKIREQLDAQLR
GYENGLEISCKEAEARVAELEKQLEEARARQITSSTDRMRPFEEAVRKLDDETRLLSTVKLVLRQREIDYQVPKRTIEIL
NTAEPARRAARPSWPLNLTFAFLFGAVLGVGAAVLIEFFDASFRGVADVERRLQRPVLGVIPASATARRPNEDSGDPADA
EPFRVLQTNISLARKDAAPGRTLVMLSAGPGEGKSTTLLRLARAMGEAGARVLLIDSDLRRPTQHQLTGAAKEPGLADLL
QGKATLDDVTRRSIAPNLDFIPCGSVGGFTLSLLYADRLKALLAGLGKSYDRIMFDAPPIIGVSDASVITSLVDDVLLLV
QYRRNPQSMVVRAQQIIAGLHKEILGIVLNRVPKNAGDDYGYYTNNYAYYSSRDVRRRSRRHRSGRDRDDEADARETFTE
PER
>gnl|bykdb|A0A1D8AS58 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Lacunisphaera limnophila] (length=737 residues).
MENAPKADKVQGPGEAYPAYYGGGQGGYGVLGQGESQMHRSMQDYLLILRERVWYIVLVFALVFSAAVIFTFTRVPRYTS
VASVQVFRNDPVVMQVQSVVNNEIRSAEDLNTQVKVLESLAIVQRVADRLTGADLELFMAPFKSPGAEVPITAAEVVYLN
RKIVPVRLSLVLQVQFSHPDKLMAAKVANLFIDEYIAYNSRLRIEDSMKAVDDLKERADQQKKRVEEMAIILQNYREKNQ
QVSLDQRKDIVTEKLKALNAYVTQTTSRLNEAEVRWRQVQERKATPALLLELPFIASQSLIVQLVQQVAAQKIVLAQMRE
RYRDKHPRMIEAHNSLTQTEKELGRAIDSMAATVEADFQTARRNDEDARANLARQEKESLDLDRDAVEYSNLERDLAINE
HLLNTLLSRMRETSMSSTIETQSARVVDRASPALKPASPNVLLNLALGFLGGLALGTAFAFFVAYVDDRVKSSFDIESVI
GLPLVGIIPEIKRMDQPDKAQIVINNQDKQVVESFLTLHSSLRLKDESKAAQAILVTSTIPGEGKSFTTTNLALTFAAHG
EKVVVIDCDLRKPNIHKSFRLENIKGVIDVCAGTHTIDQVVIKGVHPNLDVIPAGGRAKNPTQILNSRNFEHLLADLRKR
YDRVFIDTPPLAAVSDALIILPLVDGSIFTIFFNRVRRKAAQFSARKLLEANVPCFGAVLNGLNLAVSGYYYAQYYDKSY
KDYYVTMAKQDGEPDAR
>gnl|bykdb|A0A1D8AWD4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Lacunisphaera limnophila] (length=724 residues).
MPTLPSTKDSATLGDFVGLLRLRKGLIFLVLGLVLLTTLGVTALLPKWYLSTAKISVQKPESEVKLFQAQSNTYYDPYFI
QDQFRIIQAEKILYPVIESLGLNEILGKQLNDGVALPSAITYRYLISKMLRVEAPRASSIIEIDVYARDQRLAADIANAI
ARVYAEDRITLATSDQREGLAQLRKELDKQELAVTTQRDHVEKLRKELDIAGVDLSQRYSDMDIETLRQMQNSLIALRVD
AIGRKTRWERFRNIPAADRRNLVNSELIQDTNIQNLLQAYLISDQTVTRLMARLGAAHPDLIAAIDNSAKIQQQLDSQLR
GYESSLEMAFKEAEARVTELERQLAQAKVDQILSARERMRPFEEATGKLDDEQRLLTTLKLTLRQREIDFQVPKKTIEIL
NTAEPARFASRPNWPLNILFACVFGTILGVGAAVLLEYFDTSFRNVADVEGKLSLPVLGVIPHMAEAGELHDPSSPEGEP
YRVLQTNLNLALTAGKTSVLVVLSSGPGEGKSTTLRQLALCMAAAGEKVLLIDSDVRRPTQHKLAGLSRDPGLTDIVLNK
VPWTAAVVRDKSGLIDFIPAGAAANNVTLGLLYATKLKALVEEFRGRYDKVLFDSPPIIGVSDASVLASLADGIVLLIQH
RRNPESMVQRAKQIIDGLKVPVIGVVLNQVPTGTGEDYSYYTNNYSYYSHEKPVPGAAGAAGPNEARGSDRIEMRETREP
ERKR
>gnl|bykdb|A0A1D8AZK8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Lacunisphaera limnophila] (length=725 residues).
MSVPDSPPSSSAAQRAASLHGNDHQVVERRSLRDYYIILRERLWIALPVALLVSLSVGYYKAQETPMYSSVATMQFERPE
RVVQNEQVVDTSVRSDVDLNTYIQILTSGRLRTMVSQSLTPEEIKILQRPYLKDLAPGANPPPVGGLLGSMAPQSVRNSF
LINISVTNRDPEGAALLANRYVEQFMRYLLENVGGKNEFAVDYLKTRAEELRKESEIAEGRLQDYRRKHNLVSLDNSINI
ISERLRTINATLTSARLSRIDLENLLGQIERMQQAGGNLLEIGYITAYGNIAALKTQLAELQNQQSLLAERYLERHPKMI
SVANSIDVIAAQIQNDIAQSLSDLRTQYTKVKETEASYQKEYKEAEMGQLRLGELSVEFKSLENQATVAKNNYIEILNRL
NQVTTSKNLENIPVKPLDRALPAGAPFTPNIRSIIKTSIGLGLLVFAAVAIGLSFIDDRVKSAWDIEGFIGAHLLGIIPE
LGDVPDTEKHSLVNSNKTSPGSEAFLSVYSAVKIQSKLDFPKSVLVTSTIPGEGKTMISCNLAASFARHGKRVLIIDCDM
RRPMLHRHFKLTNEVGLIAWFEAGAKIPADPFTDAALGLAKVDENLYLLRSGGRSKSPTELLENPVFGQFIEAMKQHFDL
IVVDSPPMGAVTDSLLISERTDEIIYVCRFNRAYRKHIRLYIKQLRESKNELLGIVLNGLSPRRIEYYSNYRYYRSYKKY
YGSQS
>gnl|bykdb|A0A1G3ZFT0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium RIFCSPHIGHO2_12_FULL_41_10] (length=731 residues).
MNTLTHGKANQENIEIDFVALFHQLLEHKWLIAVIIAISLMGGKYYASKQIPVYNPDVLIQVESNRGVSGLTIGLPGMGG
GSGPSLGSPAAIQIALIKSRYILTPVIQSLHLNTNLSPSHPQSRWSRILSRSQPEAEMTLFTFPPEDNRPYYLVSEKGNK
ISLFDSNHQRILEGKIGERLANQDKSIQLQINQISARAGTKFTLMQYPINDRMVRSMARRITIDDPEKLGLLTLAYQDTN
PHLAARVVNEIAKVTQHKNTEKKSLEASKILSFLSKQLPLAKQDLTRAELALNRYHTTSGKIDTKLEIKNLIQEIMVIEK
QLINLRMTKHEMFYQYTKSHPSMINLKRRIAMLHEEKKELLNEVKKLPLMDQMMLNLLRDVKMKNALNTILLSKIQEMKI
IQAGLLSDVRILSYAKIPDSAVPIERAKLYGGSIIIGLIASIILIFGRKFIFPRIEDPYWTETRFNIPNLAIIPYSKEQF
KDFQDLKRNVKKPIMLLSQKDPRNLSIESLRSLRTSLQVNLSCANNNIISILGASPGVGKTFVSTNLAYLLATADKRILL
VDADLRKGTVHKYFNLDPSPGFAELIQGSVNIEEALKLTSHHNLTILPRGNYPVDPAELLSSERCKELISLFSKQFDIIL
IDTAPVLLVTDAVLISATSATNYLVLGSNVHQASHLEMAIKRLSSAGVTVHGSIFNFHNATSKKSSYQYYSSHYYYEDES
DHPKKKRRTLV
>gnl|bykdb|A0A1G3ZT33 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8] (length=723 residues).
MASIITSRDGGSLTDFFNILRLRKALIFLILALVLLTTLGVTALLPRWYLSTVAMRVEKPESEVKLFQAQSSSYYDPYFL
QDQFKTIQSDIILKPVIEILNLNAVLGKMLNNGEPLPTSITAQYLLRKMLRVESQRSSSIIEIDVYAQEPALAARIANEI
ARVYSENRINFATAGQREGMTELKKQLAAQEEVVSKQRDLVEKLRRDLNISGVDLNARYSDMEIERLRQMQNSLIALRVD
AIGRRTRWERFKNIPAGERVTLANSELIQDTNIQNLLQAWLVADQTVARLKSRLGEAHPDLIAAVDNRAKISEQLDALLT
GYEKSLEISCKEAEARVTELESQLAQARVDQILSARERMRPFEEAATRLDDEARLLTTLKLTLRQREIDFQVPKRTIEIL
NQAEPARRPSRPNWPLNIFFALLFGSLLGVGAAVLVEYFDTSFRNVADVEDHLKLPVLSVIPLSRTPARLDPDNPAESEP
FRVLQTNLNLALPPGQPGSLVVVSAGPGEGKSTTVHHLVRVMAAAGERVLLVDSDVRRPAQHRLMDQTREPGLIDLLLNK
ATLESVVRRDVVPGLDFIASGTPGGFTLSLLYANRLRELIAQCKGRYGRIVFDSPPVIGVSDASVLSSVVDGVVLLIQHR
RNPQSMVLRAKQIIEGLKTPLVGVVLNQVPHGSGDDYGYYTGNYDYYSEGHKRRKSARTEAAAVPAGGAERIVLDEPDSR
RHG
>gnl|bykdb|A0A1H1MGC9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutus sp. GAS368] (length=738 residues).
MDTVPKAEKAQGSGEAYPYTYYGTSYSGYGSPGHGDNQMQRSMQDYVLILRERAWYIVLVFALVFSAATIFTFTRVPQYQ
SVASVQVFRRDPVVMQVQGVVDNEIRSAEDLNTQVKVLESFAIVQRVADRLTGEDLKAFLAPYQKSAASSPPSPAEIIFR
ERKIVPVRLSLVLQVQYAHPDRHVAAKVANLFIDEYIAYNSRLRIEDSMKAVDDLKERAEQQKKKVEELAINLQAYREKN
KMVSLDQRKDIVTEKLKALNAYVTQTTSRLNEAEIRWRQVQERKATPAQLLDLPFISSSQLIGQLVQQVSAQKIVMSQLR
EHYRDKHPKMIEAVNSLAQTERELSRAIDSTAAMFEADFQTAKRNDEEARANLVRQESESLELDRYAVEYSNLVRDYDIN
EHLLNSILGRMRETSMSSTIETQSARVVDRAAPALKPFSPNIPLNLALGFLGGLALGTAFAFFVAYIDDRVKSSFDIESV
VGLPLIGIVPEIKRLDQPEKAQIVANNQDKQVVESFLTLHSSLRLKDESKRAQAILVTSTIPGEGKSFTTTNLALTFAAH
GEKVVIVDCDLRKPNIHKSFRLENLKGVIDVCAGTQTVDQVLCRNVHPNLDVIPAGGRAKNPTQILNSKNFELMLSELRK
RYDRIFIDTPPLAAVSDALIILPLLDGSLFTIFFNRVRRKAAQFSARKLLEVNVPCFGAVLNGLNLAVSGYYYAQYYDKS
YKDYYVTMAKQDPGTVER
>gnl|bykdb|A0A1H6KPB7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia glycaniphila] (length=737 residues).
MSSPAINQKSEASLHAGDYLQILRNRWKEAVLVFVLVFVAAAVATYLMPPSYTSVINFEIKKPGAIVSLSRGAERVLQNN
ASENYIPTQFEILVSDMNLMAVSKKLNLAQQWQTDDATAASILRGMIQVMPVRGKDLVDVKVVGSDPALVKLICDAVTEC
YKEGREAQENEVLDKAIATIQEELTRRENELLAKTDTLRKYMTTSDYIGLLSDTGNTIPTTVNNEEAVLTERRNKLSALD
DEITQLKTHINKLKSLKDSELMDYVRQTDLLAETTPGSLSVRELYTRSQTEESTLSKMHMDGYGEKHPALLSMVQEHENT
KQKLTEGLVGLKDALEQTLSLKEEGRKSIKRAFDEVTEIVRNKTQSDILVMSAIRDYRTEKSRYEDLENEYINQTMNRRA
SRPIIQIHTQAREAKVPSSPNVKMNLILGAVVGVVFGIGVAFLLNYMDTSVKTLEDVERNLNLPVLGVIPQDIGLLHLMN
GSSPDAEAYRILRTNIELKRKDTNVVTLALVSGNAGEGKTTTLCNLAYVFAQGGFSTLMIDADLRRSKLAEYNDVECEYG
LSNFLTSDLALQDVILQTHVDNLYILPAGPTPSDASGVLNSYRMRELLDEVRRRFDIVLIDSPPVLGVSDASLIVSKADA
TIMVVQPRKLPMKALVREKMVIENAGGHLMGVVMNNVDISGDTQYQYYTTYYSYYSPTEGVEPSAALNPLPVTSRSSKRS
EVAKKTESTDQPGDDLY
>gnl|bykdb|A0A1J4XH17 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium CG1_02_43_26] (length=763 residues).
MKDNHSNKNEPEDQKSYGGYYNGYGSYSYGYGSGAYEENNQRNIKDYLLILRERVWLLVFVFAIIFLGSIIYLIKATPIY
EAEAMLQILRDDTTVLGVRSVESNEVRTSEDLNTQIKVLESSTLAKAVADRLQKENLTDVFLAPYSVSNKSKEAIAEILF
HNRKIVPERSSLMIMLAYNHPDPEIAAKVANMFAEEYINYNMTLNIDGSMKAIFDLKERAKEQQKVVENIETQMAEYREK
YGTVSLEQQADIDHQELTEINKTVTDARRDFDIAQSRKNLVDQYIKSGGKLWDLSFINSIPQVEQLLSDLATKNIEISSL
EKRYGAKHPKMIEATRAKEQTEIELKSALDSSINKVYANYDHARDFLIQSEKRLAQKEKGIINLSKIKVEYSTLSRDFEV
NQGLYQSMVLRLNTEMAQIDLKKPSARIIDFAVAPGHPAKPKKVIILALGLMGGIASGLGAVFAIAFFDDRIKTAFDIES
VVGLPLLGVIPRMANLNTQEKAKTVVKGTEKTVLESFRAIDSLLRLNKASKPARVITVTSTLPSEGKSFFTTNLGLTFAA
NDEKVLIIDADLRMPSIGSSLQLDKKKGILQYCEEGATLDDIVNKNVYSNFDVITAGGKATNPTQIFLSPRFQQLLEEAK
SRYSKIIIDTPPLGVVSDIMNILPYTDGLIFVVKFNSVKRKTAKAHLSRLLESNVPVFGAVINQISLDIVNYYYSNYYDK
TYYDYYNNGELPEKKSNLDKATKLATRVKSALSKKKNKEKTLV
>gnl|bykdb|A0A1M6RLZ4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Rubritalea squalenifaciens DSM 18772] (length=715 residues).
MQQNNSLNPSEASLHAVDYWQIVKNRYGIILLTFILVVVTAAVITYVMPKKYESVAQIEIKPLGIKTDTVLGQDTSGRLM
TRQFFATQFQLIESEENLKRAAIRCQLPERWNLPMQEVVSIMTKSLNTNQERGTDLVEIAFVHSNREDVKMITQAIADSY
REMRIEDEEKRRTEASYELEKKIQAQEDLVADHRNRLATMSQKTGIPYAGDKNSIGAGSNPAELNFRENERLYQEALRDR
DSLKSIVQRLGDLDNEALISAMAGLNLPEIKVVQNLNEMYLDASRERGSLIAAGLGANHPRVKMSRTRVEALRKQLDEKV
TEVRDVLKDKLDLENQRVQRLSKSKDSAKGERLATAYDYTLFNALVQEYEQARAVLSQIKINLTNELLKDNLMVDPIRFS
KVPSEPAADEYVSPNWTLNMALGAVAGLVFGVGIAFALELMDTSVKTLEDVERFLQVPVLAVIPRDVGVLHKQSGASPDA
EAYRILRTNIEFNRKNPDDNSITVVSGGAGEGKSTTLVNLAYICAQGGYSTLMIDADLRRPKLHTFFDINNTVGLTNYLT
TDLMLEDVILQTPIDNLFFMPSGILPADAAGILNSRRMSDLVQDVKQRFDLVLIDSPPILGVSDASVLASEVDLTMIVVQ
HRKLPRKMLVRVKQAVENVGGTVLGVVLNNVDVKSDSQYQYYTSYYTYYAPSEAPQEVRAAAQPQGAQSNSADLY
>gnl|bykdb|A0A1Q6UHJ9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium CAG:312_58_20] (length=795 residues).
MENTESKDNSGQKTVKRVIKKRIISDAAGAYGYGPGYGGGYGGGYGGGYGGGGYGYGYGYGGGQGEGGSPERPNRTFRDY
MMILRERWAYILITALIILAGVILYTLRVTPIYMSVSRVQILRDSDVAIEGPGSTDRSRNNTVLTIEDFNTQVKILESNE
IIKAVKSRMKEDEIVRFMAPFNDMFTLGPRKTEEELLAENRTIAPERMSLIIRIAFEHPDPDMAATIANLFAQEYLNYTH
HTRVQKILDSIDELRIKVSQQEAKVKELDKRLVEYREQYKAISLENLDDVDRNELRDINTILTSDKRAYDAASTQWNLVQ
EFKRDGKDLADLPFIAELPQISKLLTDKSSQQVFVASAEKRYKEKHPRMIEARKALDQINKELASAIESAEQKVQAAYEA
ARQNYEQSQKRLLEKKEQILDLGRKAIVYKSIEREKQVAEGMHAAFIASMNVRLAQVNLINEGANIIDKASPGIRPVRPN
IPMNITLGILGALAGGVMVAFIVAFMDDRAKSAYDIESVVGLPLLGVIPRIRRLNSSQKAQVAVSNADRATTEAFRSVHS
MLKVNNIAKDSKVLLFTSTTPSEGKSFVVTNLALMCAMHGEKTIIIDADLRLPAMAKVLGIESRDGIVGYVEDGRPLEDC
VIKDYYPNLDVLPCEKRSQNPTQALSSEEFISMIAKFREQYDKVFIDSPPVGAVSDAIALLPYVDGVIYIVKFNSVSRKA
IQKNVRRLMVSNVPVVGAIMNMVSQGSAAGYSLNYYDKSYQNYYTMPDVEEEDSEGEEAQEGGESEDPENSENSK
>gnl|bykdb|A0A1Q6UTU9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia sp. 54_46] (length=735 residues).
MNAQDQQNSDRIVRNIDYLQVLKNRWKEVFLVFLLVLVISVVVTFLMPPSYRATSQFQIKLPKPVMDIGRGGDVVATSNV
TANYIPMQYSVLTSAEVLKVVSRKLNLAAEWGMTDEMAATNLADMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAY
KQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTSWRNGEHRSTLTAGMEEEEFRNAKAQAMDFE
RREKELASYVQELQRLPDDKLLDYVISSDLLNAETVGADALRKTYAEFSDKLKEKENLKSQNIGARHPKMLALLETERIL
GDKLNKELIGLRSSLKSKLEMVAASRKHWEATVAQKEEDLQKHVLQVPMYEQASRDYDAALDQLKELDSRYKDEIARLRV
PREAIEMYQLPTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSD
AMGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSRLHRYYELDNEVG
LTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDM
TLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSADGSSSGENADASSMKKVERSGKA
KELAATQSHDSEDLY
>gnl|bykdb|A0A1Q6UXG8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia sp. 54_46] (length=799 residues).
MANNTAPTPPVTENTEETTSLDTVLLVLRRYWFIIILAALAGGTAAYYLAGRQNYIYQKTASVLMRDAKTSSDASSERIM
AELGIDSGAANLANESFILKSTALMKKVVEDLNLNTSYWQKKDFREIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRF
MLSHSNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESSLLEMS
LTASNPQKAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEFKTKSDIVKDTDTTMSADFST
SQALEKEIFDLETQIKLAAILADNLKETERKQGLISVETGLPDSGIARQIEHYNEAYLEYQKIAGSAGSQNPITVSLRDR
MNSTRAAANKALSNYRSNLNLKLNQLISKRDSLTERLTETASREQEIIPLVREHKVKEELYLMLLSKEQENALAMAVTES
SARVLETAHGPNFPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESRNTGLF
IQDEHSVIAECFHILRNNVDSMLPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLGG
SGRKGLTSILLQQNPDTTGIIRPLGENSRGMDILYTGPMVPNPVTLLSHPLLGHILGILKKQYDAVIIDAPPYGILADTA
ILASLSDITLYAVRSGKIDKRYLFQIQQLADQGKLPNMAYIINGVNFKSASYSYYGYGYGYQYGYGTKEPQQTSRKQNK
>gnl|bykdb|A0A1V5QB01 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium ADurb.Bin345] (length=747 residues).
MENILRPPRPPTAGDAPAQPVSIGSPPPAKGFGIADLKHYFHIVVKRIWLVALCFVLSLTVMVAILVRQVPVYRCRVTLL
MSKGVPMPYSLRQVESQPMGDYLATQQLIIQSGQLISRARARLNKPAEEVSRTITRISVAPVGKTAFLAITVESLDPVLG
SDMANALADEYLDFKAEERLNTSQATVVSLTQQANRVHEELKRAEERALEFARQNSVIAIQERGNVAARILGTLSSQAAQ
FRTQKMFLEAQQPLLSRASDEAVLAALGPAGSGIPGVGLMSIAAMGVETNAPAPAVGGLEGLVEYGVVQQRGWQEQRRVK
SLLEARLAEYRTKFRDAHPLVQQTMRELKEVQDALNIELQFALRQYYAQLEALSIREQASKRVEQEWEEEALEVSRKQQE
YQNIQRNFGRLQSLYDLAFNRLKEIDISVGIEPESVQIMERARPASSPVTPRKLQSIFIAALIGLGVGLGLVFGLEYIDD
SLRYPEEVTDLLGLPFFGLVPAASWDPEDLRTHILSNIDQKSGMVEAYRNVRSALLFSVAGSQSKFIAMTSAVPKEGKTT
TCLNLAVSLAQAGARILMVDSDMRRGELHKFFGLEGGRGLSDLLAGQAKPEAVIQRTGLPNLDLVATGPFPPNPAELVLR
PEFKAFMDHARRQYDRILFDCPPVMAVSEAAILTSLAEGVVMVVWAGHTSRKLVQLAAKLIQERGARILGCVLNNLDFSR
VGYYYYSTYYGYYDYDHIRESKEDAKT
>gnl|bykdb|A0A1V5QDZ6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium ADurb.Bin345] (length=706 residues).
MEQQPSDSSGLHFLDYWRVIRSRKEVILAVLLLVVVTGTSFTLTLPKKYMADARILVRDDSLDVDVFERQIPQAYNPFFL
RTQYEVIQSRKVLYQVVENLDLQKVWGEEVNDDGSPLPLERAHAMLSRSLKVEQFRDTSLISIQVYREDPTEAARIANSI
AQVYHDQRLSMKRRELKRAIEALEGELAKQQEKVEKSEEELERIRKDLGVSVLSQGVRADKLRLSQMEADRIAARVDMLV
RKAQLDQLVNLSGEELMNASSYIVSDPALQAIRAQLIDSEVTLKLMLENYGAKHPEVLRVQAGVDELRKKLENALNGMKT
GLRANYEVALQRYEVLEKELEATRASDIDSERDRFLPFDKAEREVLVQRQILDALRARIAQEGIAVEVPRTPVEIVDPAV
PPSRPVSPNLFLNILLSVLLGLGAGVGLAYFIEYLDTSVKTVDDIERYLGLSVLGIIPQKVRPLTEEGPDSPHAEAYRVL
KTNLQFANKGTLGGAFALVSGGVGEGKSTTLFNLAYVCAQLGDKVLIVDSDLRRPVQHRILGVSNRFGLTNVLMRDVPIE
ETIKTTSVPNLHFLPSGKLPRTSLGLLDSQRMRELVKNLKARYDYVFFDSPPIMGVTDASILASEVDGVLLVVQYRKYPK
IITSRAKRMIENVGGNVLGVVLNNINIMRDDYYYYYHSYYSQYYQSDESKPADELADTSNRKKDAL
>gnl|bykdb|A0A1V6DME1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium ADurb.Bin118] (length=723 residues).
MDPLKTTPPPETKLHFLDYWRIIRIRKTVILAVFLLVVLTATLVTWILPVSYSSEARIKVDRDVSDIPGMTQTPLLPGYD
PYFIQTEFEVIQSERILSNVVHQLNLSVEWGKKYAGGERLKTQETMTLLRNRMDLNPVRNTSLITIRVFSQDAEEAARIA
NEIAETYKEYRLAQRRELTMGGIRILEDRFQDQEKKVQAAQREVDELRAKLEISDADAAGTSPTTLLEAEVLRRLKAQQI
EGEAAYVREATLLQELKTTAPEDLKSVLPTAVADPQLAELLQQLNLVEQERIRLARDLTDDHPAVVTVTRQIKDIETKIA
QRADGIIRGLEKRVASMKAYLDSLTRNVEEAMRVDIEKAEKSRPYFEAKQRLEEVMRFRSILNLKLAQERIDVDLPRTAM
VEIVDTAKPGLRPVRPNKPLNIALGVIIGLVVGVGLAFFIEYLDTSVKTIDDVERALQSPVLGVIPQNVGSLLQEGAESP
HAEAYRVLRTNLLFSRKDDKLNSIAVVSAGAGEGKTTTVFNLATVFAQGNQRVIIVDSDLRRPTLHKRFGVSNSIGLTNY
LLKQNKLEEVIQTSPLATLDFLPSGKLPSSSLGILNSAQMKDLIAQLKQRYDFVFFDSPPIMGVSDASILASEMDMTVQV
IQYRRYPQPMNIRAKQLIEKVGGNLIGIVLNNINMSQDESYYYYSGYYHDYYYRSSESSDKDEAAGEKKADDSQAKVEIK
KKY
>gnl|bykdb|A0A1V6E7N1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium ADurb.Bin122] (length=718 residues).
MADVSAKSTHHSPGKDEEVVERRTLRDYLIILRERLWIALPIALLVAVGIGYYQSRATPLYQSRATLRFEKPDRIVATEG
VTRPEVQSEFDINTYLEILKSDKLRQRVVNSLSPQEVKILQRPFLTKLSPGATPPSAGAALGSMVPSPVRNSFLISVSVN
HQDPEAAALIANRYIDQFMQQIMDSTMGKNEYATDFLRKRSDDLRKESEAAALQVQRFMEVHKLVSLDESTNLVNARLQT
VSTELTRVRLARLELESQVKQIETYQAEGRNLFEISSIATYDQIPALNAQIAELTRTQTVLGERYLERHPLMIELANKLR
VAQEQLRTQVSLAIADLKSRLAKTADSERTFEQEKQLQETEFFKLRDLRGEYNSLKNQADVAQKNYIDILDRLNQTTTTK
SLEKLPLQPLDRAVPAGAPFTPDLARIIRTSSLLFVALFLAVAIGLNFIDDRIKSTWDVEHYIGTTLLGIVPDLADTPDD
DRYRMVLDHRQSPGLEAFLSIYSSVKIHSKLDFPKSILVTSTIPGEGKTLVSANLAASFARHGRRTLLIDCDLRRPMMHR
HFKQSNQAGIITWFEKGADLSVEPQKNPDLGIISLGENLSLLCSGGRSKTPSSLLETPAFTQLLERLKQQYELVVVDSPP
LGAVTDSLLLAERTDEIVYVCRFNKALRKHIQLYTKLLLSGKNEVLGIVLNGLSPRRIKYYSNYRYYRSYKKYYGTHG
>gnl|bykdb|A0A1V6J089 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium ADurb.Bin018] (length=704 residues).
MAEESQTTALHFLDYWRVIRDRKEVILAVALLTIVSGTAYTLMMPKKYTALTQIQVREDAMDVDPFYQRDINRMGYNPFF
LMTQEKILKSKPVLTTVIRNLNLQKVWGAQLNEDKSAITPELALQILQRSIRVEQDRDTMLMNISATSEDPKQAAAIANE
IANVYRERRLADKRREIQHAIDAMSNEVRKQQERVEEAEAELERIRQERGIALIGRGLMSIRVESTRLNALENERSAARV
DMLVRKARMDQLEDLEGDKLMDAAAYIVQDPTLLSIRQQYIDSQVSLQLMLKNGVVGENHPDVLRLRGAQDELRRQLDSA
LAGLKAGVKADYEVARQKYEALDSELASIKATDIESESENYLPFDRAERNVAVNRDILTALRARITQTGIEVEVPRTTVD
IVEEADPPDRPSSPLVVLNIFLSVVLGLMAGTGLAFFVEYLDVSIKTVDEVEKYLGLPVLAVIPQQSRPLTEAGQSSGQG
EAYRSLRTSMALLGREDNKKIFAVISGGVGEGKSTTLFNLAYVCAEQGSKVLVIDSDLRRPVQHKMVGLANRAGLVNVLT
GELKPEDVIQETGVPNLWMLTSGRLRRGTIGIMNNTRLRNLLDHLKEQYDYILLDSPPILGVTDAAILASEVDGVLLVVQ
YRKYPKIISLRAKRMIENAGGQVLGAVLNNINIMRDDYYYYYHYTTRKYYGVVRHENDDNLTES
>gnl|bykdb|A0A1V6JU76 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium ADurb.Bin006] (length=724 residues).
MSYSYYTSQAAPPEASESSSSNLNLRHYWNIVLQRRWLVIATFVSVFVLCLVYLFKAPRIYSATARLQIDRESAASLNLN
EVVMSMTDQDYLQTQYRNLLSRSLLEIVIKREKINEDSRYRDSPDVARALAEDIRINPIRLSRLVDVVVEHPNASKAAGI
ANALVEEFIEQNLVQKQKRTMDMLFFLRSQANGLEVDVAKAEEDIQNYRAQVKFVSLDSSYNIVAEALSQSQAQYAMAKA
QAQTTQTIVEELDRHIQAGNPLETFPKIAADGKVNSLQLQLSGQENELAGLLKRYKDKHPAVIQARSKIEETHRSVQGAA
QQVAEILRSEARLAKASEQILAANVKEWEDQQMEWNKAKMQYDVLMRKAQSSKALFDTVLAKMKEIELVQRDKGNNIRVI
DYAYAATMPVKPRVLLTLFLGAFGGLGLAIGLAFFVNFLDDSIKSQDDVELYLHLPFLGYIPNIKTNSVVESGLQAHLHP
QSNAAESFRTVRAAIALGAKAEKMRVFTVTSTIPSEGKSLVASNLAVVVAQTGLRTVLVDADLRRPSLHKAFQLHSPMGL
TAYLTEQTNRVDDVIQTTEVTNLDVACCGQIRSQPSELLGSQRMVQFMQELSKRYDRVILDCPPVSAVSDPLILSAMADA
VVFVTKFNKVRRDHARRTIQRIQDAGIHICGVVLNDIDFEGRDSYYYSYTYYQNRYYSSYHRERAESRRQAVVESSGSTP
APHA
>gnl|bykdb|A0A1V6JZ45 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium ADurb.Bin006] (length=724 residues).
MDATKPNPISDSQLHFLDYWRIIRIRKTVILAVFLLVVLTTTAVTFVLKPTFMSTARIEVEKQPTDFDPFLRPQVQNQFD
PYFIQTEFEKIQSKPILYKVIESLDLRKTWGQRLKNAVSEPEAYLLLRRNLDVRQSRNTSLIEIRAYSENRDEASAIANE
VANVYKESRVEEKQRQTSAGISKLRAKLDEQAEAVAKLQDNVDQLRAELNIPDSINDASVYQTSLEREKVSAMAQELTRA
HSEYVYFLTKLEDLKKLDRTSMREAVLVTMPTEARLGELLGALSLAQQEVARLREDFSNDYPEMKRKLALVEQIDQQVEA
RLTGILTGLENQVISLKARRDELQKAVDDGKKLVVEEAKRSREYWSSKRELENKQKIRDAILMRMLQEEVDAELPKESMV
RIVDPAEPALRPVRPNIPLNIALGIMVGLVMGVGLAFFIEYLDTSVKTIDDVERSLSAPVLGVIPQNVGILVNEGPDSPH
GEAYRVLRTNILFSRKEPGANTLTVVSGGAGEGKSTTILNLATVFAQNGQRVLVVDSDLRRPSLHKFLAVSNSIGLTNYL
MKQNTLEEVIQTTKLPMMDFLASGKLPSSSLGILNSTRMKEFIKDVQRRYDFVFFDSPPIMGVSDASILASEVDLSVLVV
QYRKYPQAMTLRAKQMVEKVGGTMLGVVLNNINISQDSYYYYYSGYYYDYYSKGEYGESKSSEDDESRKAAPKKPAEAEL
KTKY
>gnl|bykdb|A0A1Z8WN04 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium TMED67] (length=730 residues).
MDNTSGSEQSSEKLHILDYWRIIRVRIATILLVFLLTAITTTVVTFLIPPTYMSLSRIAVEKDTSDIAPLMGAQSSQSSF
DPYFISTEFEKIQSQIVLDAVVETCELREEWKDDNGGESLSELRARKLLEKVIDVSQYRNTSIIELRAYDGDENLAREIA
QALAEEYKKYRSNLQKGRVEAGINKLKERMEKTNNEISLMQAKVDSLRVTLGISDAAGEDSYSIVEPEIVRRYESELITA
KSLYTQQATLLQGLKEQGDEELRNSILTAYPDAQLDALVREYQTGQNSLANKSIDLGEGHPTIKSLRAVLSTFEGQIQNR
IKGILAGLELRVKSSLAQVNELQKAVDSAKSKEAKVQEEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVE
IIDKADNPIRPVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNTAVLGVIPQNVGSLVDEGEESPHA
EAYRVLRTNILFAGRQSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYFKVSNNIGLTNLL
LGQNTVEEVVQITDIPNLHFIPSGKLPSSSMGVLSSAKMKDFVADMKSRYDYVFFDAPPIMGVSDASVLASAVDLCVLVV
QYRKYPQLMTQRAKEMVTKVGGNLIGVVLNNINISQDSYYYYYSGYYYDNYYKSREDEEGSDGTGSDNKEIKDKSITTEV
DSSSDVKPKY
>gnl|bykdb|A0A1Z8XU55 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiaceae bacterium TMED76] (length=738 residues).
MAKQSETKLHALDYWQVARNRYSVILXTFALVFMTALVIAYLRPSEYLGRVXIQVQRVARDIEVFRETGSVGNLGSEQLP
YMTFMQTQFEIIQSRETLKQVISKGKDSAGNPLDLKKAWGVNSDEDAYRILKXKVETQDVRGTDLIDIEIYDTDPKLAAD
IANAVADAYNIRRQEEEKNRATKALTLLDTQIKKQEGRLEAARNNMIELMEELNIVDLSLGEPVWLRGSQPNTGTASLVL
AAKQREFAAEEAIQNLRSTISSLTQLEGEELIKSAVDLGVKNETLTSGWTEYQSLELNRAALVDSGVGIKHPKILNIDSQ
LNLRMKQLLGAVETHKKALSTQLTMAEQQFENSRESKERTEKMSLQERKQNVRYIEAKKEYELSKEMLNGMQSQLAKETI
DKEGQRTPLVIHEQAEPSDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIPKDVG
VIHKQSGLSPDAEAYRILRTNIEFNRKNADANSITLVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFFN
INNSVGLTNYLTTDLQLEDVILQTAYENLYFMPSGILPADAAGILNSRRMSELIADVKSRFDLVFIDSPPILGVSDASVL
SSEVDLTIIVIQHRKLPRGMLVRVKQAIQNVGGTALGVVLNNVDVRSDNQYQYYTSYYTYYAPRNLDPNMNSNSDDLFKS
GDKLASNDKDNLTAEDKF
>gnl|bykdb|A0A1Z8ZMT6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiaceae bacterium TMED86] (length=689 residues).
MAKLRSTPEPVDSYYDEAQAEIKKSPGLFDLAYLLPRLIARWHWILIGSLLGVVLGVITIRMSVPEYRSTATVRVKSQNS
GSMGNSSDSDDIDLQSLEAAEDIRSDFDRTELFLAVASDPTVRNLANLIPPEAPSIMEVFTAKKAEEKKVFAEAPAPEQL
AGIISGWTSSEVRRGTRLIDISVNHTDPDVAQVIANQIIQQFINIREGVNEEGKKSDLQHLLTAAKERESELETARRRAG
TYTPALEAEKEMAVAEKAIQDLSIRYGLKHPKIISGTDQINLKTKILLSAMKDVLSSDLETDYWRGFQDQIDDIENEENF
KDLRNAMKLRASLLTNSVETKNELYNTLLSRVGVLKTDAEGVEAEVIKHEDAPRAWAPFSPNRKKIMIKNTLLGLCGGLA
LAFMFQFVDNKIHGVADVEQTFGISILSAIQKLPPEEELLEKMESLRDLPVSMKHISPTLAVPGWKTDFVHSEMFRVLRA
SISLLGDANQRKITMITSSIPGEGKTFCAANLALAYAKQGTRTLLIDFDLRKPAVHKIFNEERAARPGIVNVLNGTAAAN
QAITVYPGLDTLSVIYSGPKSPNPGELLEPGRLRALIGMFAANFDHIVIDSAPLLPVPDTRILAPLVDNLALVIRADHTP
VKSIQGALEMLKDDGVSSSGVILNDFTENRLQGGKYGYGYGYGQYGDDA
>gnl|bykdb|A0A1Z9CBK5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium TMED102] (length=728 residues).
MERNTGSDQSSDKLHILDYWRIIRVRIATILLVFLLTAITTTVVTVMLPSTYMSLSRIAVEKDTSDIAPLMGVQATQSSF
DPXFISTEFEKIQSQVVLDAVVESCELQEKWKEHYGGEELDEVRARKHLEKVIDVSQYRNTSIIELRAYDRDRGLAQEIA
QALASEYKNYRSSLQKKRVVAGIDKLRSRMTTINEEIGAMQANVDXLRVQLGISDAAGEDSYSIVEPEIVRRYESELITA
KGLYTQQATLLQGLQEQSVEELRESIMTANPDAQLDALIREYQTGQTTLANKSIDLGEGHPTIKSLKAALESLDQQIDNR
IKGILAGLELRVQSSLAQVXELQKAVDDAKAKEAKVQEEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVE
IIDKADTPLNPVRPNKPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNAAVLGVIPQNVGSLVDEGDESPHA
EAYRVLRTNILFAGRTSEXXTTFSVVSGGAGEGKTTTMFNLAVIFAQMGDRILVVDSDLRRPSMHRYFKVSNNIGLTNLL
LGQNTLDEVIQTSDSPNLHFIPSGKLPSSSMGVLNSAKMKEFVAEMKSRYDYVFFDAPPIMGVSDASVLASAVDLCVLVV
QYRKYPQXMTQRAKDMVVKVGGNLVGVVLNNINISQDSYYYYYSGYYYDYYYKSREGEEDAGEEKKADKDQKLVAQANPG
GSDVKPKY
>gnl|bykdb|A0A258ANJ7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium 12-59-8] (length=761 residues).
MSMKMMSSPSPKASFNTMQPTSLSLPQSPMEMTQRLEADSESSSSFMNPAQLVDGMRRHSWIPITLSLFGLILGYAYFKR
QKPVYEAVSVAQFGSEQSSLLGLNSMSTPGLGDEKSVNTLIQAAKSREVIGRVISELNLTQLPSFSGGHPADSKEARDNA
IFMVSSMIRISLRKDTRLIDFNVTGADPEQVAALSNQAVLSLVSELESQKSKTLQGAIQALVAEGQRLQDKLKKSEIAMH
DYKRSNQAISLDERKDLVLSKLKELGSELNQQSKERLTLETQLQACKEGTLPRDELLSLPSIASHPKVSGILSQIASQKS
ALAVLAERYKPKHPKYEAVQVVIHNQEQQLTTILDDAFHLLQSSWEHARELEHRLQEQLKKQESEALDLEQLAVQYNVLK
REMESDQAVYESVLTRIKQVDVSKGMETPPIWVHQLAMVPGDPVSPNAKKVVGSSTAGGFMLGLAIIGLIVIQDRSIRSV
DDARQKLRVPVLGMIANQRQIATASEQQKGHDFTQGLTPALIAHKAVAESFREFRAIIARMARCPHTCHMVVSAVPDEGK
TFVSTHLAVSLASQGFRTLLIDMDLRHSQLAQVFGIPNTRKGVVDLLLEEVSFAEVCLSGGIAHLAIMPAGKRVANPAEL
LSTCGVERLKEMAFSAGFDRIVIDTAPLIPVNDTLELGTLADSTFLVVRCNRTPADIILEAIRKLHQTGIPITGLVLNRL
TQRTRSFDQYYHRSYYKGSETDETAPLRPASRGLHTPSNFG
>gnl|bykdb|A0A290Q2Z2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=765 residues).
MLWWSRRVWWWRPEKTSLLTGGEGNSLAARSMAHTHVSKEGASLADFFHLLRLRKALIFLILSLVVITTVVVTAFLPKWY
LSTLNVRVEKPEGEVKLFQAQSSGYYDPYFLQDQFKIMQSAKVLYPVIENLGLNDKIGRSIGAYAPLATDETYNYLLKKM
LRVESPRGSSMIEVGVYSQDAALAAAIANEIARVYSDDRIMFATSEQREGLTQLRKELESQERTVSLQRDMVEQLRKDLG
ISGVDLNARYSDMEIETLRQMQNSLIALSVDAIGRKTRYERFKSIPAEDRINLINSELIQDPNIQNLLQAYLIADQNVTK
FRARLGAAHPELIGATDNRAKIKEQLDAQLRGYESALEIAYKEADARVAELKNQLAQAKVDQILSARDRMRPFEEAARKL
EDETRLLSTLKVTLRQREIDFQVPKRSIEILNYAEPARRAAKPSWPLNIAFAVLFGGVLGIGTAVLIEFFDTSFRNVAEL
EGRLGKPVLGVIPHSSEAVPPAKSGIVEDPAELEPFRVLHTNLNLALKGVTPGRSLVMLSAGPGEGKSTTVLRLARSMGA
AGERVLLVDSDLRRPTQHQLAALPKEPGLADLLQGKATLEKVTQRGVSPGLDFIPCGAVGGFTLSLLYIDRLKALLAELR
GRYDRVIFDAPPIIGVSDASVLASVADDVLLLVQHRRNPHSMVVRAQQIIEGLHKQIVGVVLNRVPVNSSDDYGYYTRNY
AYYSARENRSSERRDKRSRTEQAERAKSDERITFTERERDERRKS
>gnl|bykdb|A0A290QGD9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=736 residues).
MNPPASPAPHGGPDQAPESPYGYGAYQQPPDGPQQRGFQDYVLILRERIWYILAVFLVIFSCVLVYTLTQTKIYQSRSLI
QILRRDPAVLKVQSVTDNDVRSLEDLNTIVQILESGTIIQKVSDRLTGEKLAQFMAPYLKGGSGDPLTPAEVLFKNRRVI
PRRMSLIIEVQYRHPDRVLASDIANMFVDEFIAYNSRVRIDESMKAVDELRARVNDQRKKVEELATRLQTYRETHKMVSL
DQRRDMVTETLKARNIIVTQTNARFKDAEVRWKQIQELRAAGRDLTELSFIAIQPIIGELKKQQAEQKVVVAQLSERYRA
KHPRMIDATRMLSQIDAELAKATAEAASIVEGDYQSALRNADEARSGLVEQETQSLGIDRAGVEYESLDRELKIEEQVLQ
HLMGRMRETTMSSTLDTQNARVIDRAFPSQPEQYVKPVILLNLGLGLVGGLGLGLAVAIFVAFIDDRVKSSFDIEGQMGL
HLLGIIPQVRKMPAPEKAQVVANHADRQVSEAFLTLHSSLRLKDDARAAKCILVTSTIPGEGKSFTTTNLALTFAAHGEK
VVVIDCDLRRPNIHKSFRIANQRGVIDLCGGDTRVEDVVVKGPHPNLDIIPAGGRAKNPTHVLNSAGFEHMIADLRTRYD
RVFIDTPPIAAVSDALIILPLVDGSIFTVFFNKVRRRAAQYAARRLIDSHVPNFGAVLNGLNMNVSGYYYGQYTDKSYKD
YYVVMSKKDDTQSPLK
>gnl|bykdb|A0A2A2PYE8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium Tous-C1TDCM] (length=743 residues).
MSSESGEKQSQNSSGYGYNYGGNYAGYSAVGYGYGEGGGGGSHSQRTFQDYLLILRERIWYIVVVFLVVFSSSLVYTLSD
TKIYQSSATVQIFRRDPTVMQVQQVVDTDIRSAEDLNTQIKVIESVTMIQRVAERITGDDLRAFLAPYERAGTDITYVAE
ILAKNRKIIPQRLTLVVTVAYQHPDRFVAAKVANLFAEAYLDHNISLRTQESNNAVEGLKGTVEEQQKRVERMARELQEY
KEKNNMVSLDQRKDIVSESLKAINAEKTRAQIAMNAAEGRINQIKEVRQRSGDLTELPFIASQPQVVQLGQLLAERKIAI
ATLRERYRDKHPKMIEALNSFQQTERELKRAVENVSAQVESDFQAASRTFKNLEEDLAKRTEDSLQLDRAALEYNDRERE
YRTNEKILDAIVARSRETSMTSGITTQNARIVDKAAPSPESKPISPNVPLNLGLGIAGGLGLGLAFAFFVAFIDDRVKSS
YDIEGVVGLPLIGIIPQIKRMDQPDKAQIVINNADRQVSEAFLTLHSSLRLKDESKNAKCILVTSTIPGEGKSFTTTNLA
LTFAAHGERVVVIDCDLRKPNIHKSFRLENLKGVIDICAGKATIADVAIRNVHPNLDVIPAGGRAKNPTQILNSKGFELM
ISDLRKQYDRVFIDTPPLAAVSDALIILPLVDGSIFTIFFNKVRRKAAQFSAKKLLEANVPNFGAVLNGLNLAVSGYYYA
QYYDKSYKDYYVVMSKNDTEQEK
>gnl|bykdb|A0A2A2QX62 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiae bacterium Tous-C4TDCM] (length=726 residues).
MNPTTNTSEASLHAIDYWQVAKNRYGVILLTFLLVFMTALVITYVMPKKYESTAVVQVRPKGAGAVMMPGTEPRGQYEMT
STFFPTEFEVIKAQKTLDSAIENLDLVNRWNSDRESVRGTLRGIVSAQNIRGTSLIEIRVRYNDPKDAQAIASAVSEAYR
ERRTALQSEVASQAMDQLGKAVVQQKDLVEDKRKLLSQIIRQEGIIYQGDSSVFQGTSGFDKADEAETAAREYDRLDREK
IQLESQIETLLKYDGAQLLAHASGLSLPDNVIPVLLPQFQSAKREYDSAMSSGLGERHPKMVSLATNLVAMEKQLDEAVA
NLRETLKVKLELSKEQLARLKSRKESTNEDAIGKGIANQTFIDAKNEFESALRLLETLQAKEIVERMQDKVTDDPIIIHE
EPVVSQVPVSPNVTLNLALGTVVGLIFGIAVAFFLEYLDTSVKTLEDVERYLQVPVLAVIPKDVGVLYKQSGMSPDAEAY
RILRTNIEFNRKNPEDNSITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFFEINNSVGLTNYLTTEL
MLEDVILQTPVDNLYFMPSGILPADAAGILNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMIVVQHRK
LPRNMLMRVKQAVENVGGHVIGVVLNNVDVRSDSQYQYYTSYYTYYAPAESQSLPSQGSSSAPAKPAPPRSTSRGDAADD
AKQDLY
>gnl|bykdb|A0A2A2R5D6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium Tous-C9LFEB] (length=722 residues).
MAAPASEVSLHFLDYWRVIRNRAAIIVTVLLLTLMTGYVVTVYVMQKMYDAKAQLRVYKEKSDVEFMGNSRTDAPFDLVF
FTSEISTIQSKKILNPVIEKLGLQKEWGTRLFGGSNLPMDKAFVLLNNRVDVNVQRNSDILEIRVKSDLPKEASDIANAI
MDVYIEMRRADLQTRESRGFKTLDDEIAKQGEVVQRAKDYVEELRKSLNLNMVGGGENETQMIEEEWKRKSALLDDVRAE
YLGRQVRYERLNRLSTNEFLDAIVAMGIEDANLTSLRAKKYAAESDLEQMRKSGLEGNHPRIKSREAELAKIDEQINANA
AGKRRALEIDVQVTKARVTQLEKEVGVLTDQVRMQKTTELAKFREAKKEQDRQQLLYDQFVIRKKQSVVDKQITNDPATI
ISKAEPNDMPFRPNLTINLIASGVAGLVLGIVLAFFIEYLDTSVKTMDDVEKLLDLPVLAVIPDGVGPLIREGADSPHAE
GYRILRAKIDLNPKSGAGNTLTVVSGGPGEGKSTTLFNLAYVCAQSGQSVLLVDADLRRPTVHTILGIENEAGISEAMRG
LGEAHQYIRATSVPNMHVITAGDMPASEMGAFSGLKLREILNDLKLRYDIVLLDAPPVLGISDGAVLAHEVDFTLLVIQH
RRYPRDISMRAKRAVEEVKGNLLGVVLNAVAVKSDEAYYYYSSYGNYYYNRNGEKKPRSGAATPQRATLAKNDEQSHGSE
DF
>gnl|bykdb|A0A2A2RGF2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Pedosphaera sp. Tous-C6FEB] (length=730 residues).
MDAAPKPTDSAPATPENRLHFLDYWRIIRMRALLIFVVFALVVGTTALLTHNMEPTFMSTVRMDVQKDVGDISSLMPQQQ
QGGFDPYFVMTQFEILQSKEVLYKVIDDLKLVPRWDQKYRLGQSKVKAYEVLTKLIDPRQVRNTSIIEINVYSKDKAEAA
EIANKIAEIYKENREAQRKLQAEKGLKILRDRLADQDALVRTALTNVNQIHQDKGLNVIHEVGGSVMSLETDTIRALESQ
LIEIRGLFTKKQTSVVELKKLKPEQLRNVLGPPVVNDEILARRLEEHSAAEKEFVSKGKDLGPNHPDYVRMQALIVKLNQ
QVEDRVSGIMLNLETDLKAQAAALALTETKLEEAKVRNRTAAEKNRTYQMALTDLEDLKRLRATMNAKIIVEESDVAMSR
SNSVRVTDFAEAAIKAAYPKMVLNVALGAFVGLLLGIGLAFFIEYLDTSVKTIDDVERALSAPVLAVIPQNVGALLDEGM
DSPHAEAYRVLRTNVLFTRKDDQANAITVVSGGAGEGKSTTVLNLATIFAQNGDKVLLVDSDLRRPSLHKRLGLSNSLGL
TNYLLGQNKLEEVVQHSTLANLHFLPSGRLPSSALGILNSPQMKDFIKEAKQRYDFVFFDAPPIMGVSDATVLASGADLA
ILVIQYRKYPQSLAIRSRQMVEKVGGRLIGVVLNNINLASDASYYYYSGYNYHSNNNADEPGTNGKPPGKADRHKPAAPT
ADAPTIKPKY
>gnl|bykdb|A0A2A2RGK2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Spartobacteria bacterium Tous-C9RFEB] (length=714 residues).
MSTDKVIQPRPPESAPPIESIDWREYFHAVIDRLWIVILCVILGGIYAGFTLSKIETTYRARAVLFIEQDQARILDPRFS
QVRDEQIRSIDMINTVVDLIRSYPFSQRVSARLKLDQDPRFLSAVGISAKDATNDRTAGALSGMVGVIYRPQTRLIDVSI
TSRDPNLSVKLANAYADEYIRYVFEKRSDAAKSATQFLVEEADRLRKKLRVSEEAMQSFRERERAASIETMLSSAQSQVG
EVSNNQSLIQRRIEQIDSDLAVIRANTGEPEELLTLPSVAAEPKVAQYSESLNARQRDLTIVAQRYRSKHPTYVAIKTQI
DLTKADLKRVLKDAVTLLANSRNRLEVQSTEMKTAREAAEKRLLEVTHKSIEYNDIKREQETDQALYNSVISRLKEVDVS
KQLTESPVRIHETAVGAGPIRPSATKKWIQSLLGGAAIGVGLALLMFFMDTSMKTVDQVESVTGVGVIAAIPKLSLNARA
SVLVTNEERSGIVAESFRSLRASLTLHRINEDARTFLFTSSMPSEGKTFCSSNFAVTLAQQGFNTLFIDADLRKPGGSIV
FFGENRKPGLSEVLMRTCTMKNAIVPTHIDNLQIMTAGGRAPNPSELLTYENIDRVLKEALSKYDRVVVDSAPLLAVSDT
LLIAPHIDLCTLVVRAFTTPKKMVMRAIKSLEETKTTPAGLILNFLPSGRGGYYAYYYSGKYYGSYGAKGVYGE
>gnl|bykdb|A0A2A2XV69 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Spartobacteria bacterium AMD-G4] (length=718 residues).
MMNSSDSNEIQLHFLDYWRVIRIRLPLIVLVFLLVVITTGVVTYFLPKQYESSVTMQVNQNDTYLQVFDDRGGGRGFDPR
FITTQFEIIQRKEILYPVIEALGLEQTWKKLYGIAGKEQTIFRLRKMIDVREIRNTELIQISVLDQDRNEASEIANRIAE
EYQRRRIGEQQGTVNRSLIQLKDEVAKQSRRVDELRAEAQRIRIENEIQDLNPDSVVDPMQAANEVLLSVEQQVSTERLR
VSTLRAKYEQISKLSDDQIMRSISTLDVQDPTITQMLPQFQEVASEEARLLNSGLGVNHPTVKSMRAKKEVMATQLVTQI
ASLRASMEANIRIGEDSITQLEQRLRESQAKQQTSKTRASGYYEAKNNYIQAKKILEAAEMRLSTETMQRTMPQDPTVIW
ERAEPAEYPSRPRVLLNMILGVVVGIGFGVGLAFFIEYLDTSVKTLQDLESILKIPVLAVIPKEISLLINGNDDNPDAEA
YRIMRTNIEFNRKNPASNSITIVSGGPGEGKSTTLNNLAYTFAKGGYTTLVVDADLRRPSQHRIFGIDNKNGLSDLLTKQ
LSLEQVVHKTKVENLFFMPSGLLPRDAVGILNSQRMMEVIQETKSRFDIVFFDSPPILGVSDASVLSSELDLTIIVVQHR
RFPKEMIQRVKQAIENVGGNILGVVLNNVDIRHDQSYGYYTSYYNYYSPSKNVPEKSGQNAQAASPATTKPTPQSGEY
>gnl|bykdb|A0A2A2XVF1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Spartobacteria bacterium AMD-G4] (length=959 residues).
MSKRVDFPRRAFCEFRGIFVRFVFLFLIGMSVAAEPSNEYKLAPNDLLDFRVFQEPELDAVVRVSGDGQAIFPLVGGVAI
AGASISEAIELIKSRYRDGYLKNPQVTLTVRSYAKKLFTILGQVQQPGSYDIQSQIRGMSPLSVSRMVVSASSSLTRNAW
RAVMKKPRSSSRREMSSPSASPYFKMLDPSRPPAEKRFGSVLPTIHSSLDEVGTALDLRRIYHLLLQRWWVITLLVGVSM
MAATGYVMRQPKIYESRAVLQVQQSEQQVVNIDGVSQENPSSPDFINTVVQSITSRNLMLRVIDANKLRTNPAFVAPGAK
PTEIQLADKLRGKVRAVLRRGTRLIDIIVEDKDPVMARDLAASFVKEFLRENFSQRLSVSRVATDFLQEESQKLKKKLEE
SEIKLQRYKEQNQAVSLEERQNITVERLRELSSKATEAKSERLRLESDIEQVRKVPANNTDELLRIGSVATIPQVAEARR
QLSDSNMEIAAMQDRYGERHPKFIAALAKAESLKKSLRESAGKAGDILNRQYEAACQTESKLTVALKEQEVAALDLNKMA
IPFNVLQREVESDRVLYESVIKRMKETAVTGAVDQAPYTLIEEPLVASLPSKPNRTRTLAMALIMAFFFAIGAVIFFDSL
NSSLRSVDEAESFLHLPALVGIPNRTLKGFSQLKQTLERECAALPGRLRQARNIGKPHKKKESSVLGDIQELIRPAPIAR
TDSEKYPIATIEEPESGLAEAYRTLRVSISMLGPEEERRVLLFVSAIPEEGKTYTSLNTAVVFAQQGLKTLLIDADLRRP
SLHKALLTVDTLPNGLTDYFSGNSRLASVIIPTEIENLALLPAGRRAPNPAELLSSADIPKLFAQLLKRYDRIVIDSAPV
NAVSDTLILAPHADKTILVIHAGKTPRKAIQRSVHLLRKAQAKVAGFVLNRLPTGRAAGYYYYYYGDKYEKDSVYGTKT
>gnl|bykdb|A0A2A2XXF7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Spartobacteria bacterium AMD-G4] (length=716 residues).
MNKETDLKKPPSASPPPPSQEGIDWREYFHAVVDRLWIVILCVVVGGIYAGVTLSKVETTYRARAVLFIEQDKSRILDAK
MEQVRDEQIRSIDMINTVVDLLRSYSFAQRVSARLKLDQDPRFLAAAGISARDASPDRVAAALSSMSASVYRLNTRLIDL
MITSADPNLSVKLANAYCDEYIRYVFERRSDASKSATQFLLEEADRLRKKMRVSEEAMQSFRERERAASIENMLASAQSQ
IAEILGVQNEIQKRIQQIESDLAVVRTNTGSVEELLFLPSVAAEPKVAQYSESLNARQRELTLISQRYRAKHPAYISVKT
QIDLTKADLRRVLNDAVNLLESARNRLEVQANETKIAREKAEGRLIEVTAKSIEYNDIKREQETDQALYNSVLSRLKEVD
ITKQLTESPVRIHEPAVGAAPIRPSATKTWIQNLLGGLAIGIGIAIAIFMLDTSIKTVDQVEQFTGVNVIAAIPKLSLST
RASVLVTNEERSGIVAESFRSLRASLTLHRLNESARTFLFTSSMPSEGKTFCSSNFAVTLAQQGFNTLFIDADLRKPGGS
IVFYGENRKPGLSELLMRSCAMKNAVMPSHIDGLSILTAGGRAPNPSELLTYENLERVMSEALSKYDRIVVDSAPLLAVS
DTLLVAPHVDLCTLVVRAFGTPRKMVARAIKSLEETKTHPAGLILNFLPSGRGGYYAYYYSGKYYGSYGAKGVYGE
>gnl|bykdb|A0A2A2XXW5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Spartobacteria bacterium AMD-G4] (length=720 residues).
MEEQFQSQQGNSMSGADPSINLRQYWHVILERRWLIVATWSVCIIAGVLYAFQATPMFRAIARLQIDPENQGVLNLNSMA
LGNSDQNYLTTQYRNLESRSLILAVMNKLKLETDDERYTKSVDKVTAVTKDIKIVPIRLSRLVEVQVTHPKGEQAQRIAD
TILQVFLQQNLDDKKSKALQGLKILEQEATGKEVELEALQGKLQKYRKDKGMVSLKDAQNIDAATMRDLKIAYETLRSTA
DVAKQIAQQAQEWVAAGKDITDFAPLAKDEQVAYLRKQVNDNSSKLAGLRTKYRERHPRVIQPATQLQADTQKLRDESER
ALQGIFQMAELEKSREVEALRKYTESVERVFALDEAKISYDIMEQQLKRVEGFYQTILTKAKDFDIGAKDLLQNMKVQDP
AFAPLKPVSPNKPLIFVGSVVGGLAVALGLALFFNFLDDSIKSQEDVENILHLPFLGYIPNIKSISIVERDLQSHLHPTS
SPAEGFRTLRAAISLAKNADKLRVMAFTSTIPSEGKSLVASNFAIVTSQTGLKTLLVDADLRRPSVHKAFQLQSPVGLSA
YLSGRTDNFSEFVHTTEVPNLDVICCGAVPPNPSELIGSNRMVRFLEEASRRYDRVILDCPPVSAVSDPLIVGAMADGMV
FVTKFNKIRREHALRSVQRIQDSGIHLVGLVLNDIDFEGKDSYYYSYHYYQNQYYSSHYRNKSADEPADKKSASEKSKSA
>gnl|bykdb|A0A2A2YDW8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiae bacterium AMD-G2] (length=717 residues).
MQPQSSNSEAALHAVDYWQVIKNRYGVILITLLLVFMTAAVITYVMPRKFESRAVVQVNPSNRFGTAFGDDNNSQIQMTP
QFFATQFEIIRSQMTLRRVVDKLRLTNRWNVTEEDALMTLTGIVQAQNIRGTDLIEITVLHPGAEDARDIAVEVYEAYKA
RRVQEETDLSENASKQLEQAVLEHSDVVEEKRKQRDNLQRRAPSVVRDFLTGNAGNGYQSMQANVESQVEAAKTTLAELD
SMIASIDRLSADEVIRYAANLEVAGQDLKSLFPEYQEQVRMLSGMQVQGLGPRHPNVLAQESTVDSLFKQLQASVVSFKD
SLKIKRETKNVELVELNNRLVEVKDMSKENIIAMTQIQNVHDEFTTQQKLLDEMKQKLTTDRINLRQPQNIIQLHEEPVV
ARFPSSPKVNIALILGAVVGLVFGIGIAFFLEYLDTSVKTLEDVERYLQVPVLAVIPKDIGVLHKQSGMSPDAEAYRILR
TNIEFNRKNPEDNSITVVSGAAGEGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFFDINNSVGLSNYLTTELMLED
VILQTPVENLFFMPSGILPADAAGILNSRRMSELIADVKQRFDLVLVDSPPILGVSDASVLASEVDLTIIVVQHRKLPRN
MLLRVKQAVENVGGHVLGVVLNNVDVRSDSQYQYYTSYYTYYAPAESELPQPQPSTSSRPATPSSTASTSNQNDTLY
>gnl|bykdb|A0A2D5MR66 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=728 residues).
MDKTSGLEQSSDKLHILDYWRIIRVRIATILLVFLLTAITTTVVTFLIPPTYMSLSRIAVEKDTSDIAPLMGVQASQSSF
DPYFISTEFEKIQSQIVLDAVVATCELREEWKDDNGGEALTELRARKRLEKIIDVSQYRNTSIIELRAYDGDENLAREIA
QALAEEYKNYRSKLQKGRVEAGIGKLKERMEKTNDEISVMQAKVDALRVKLGISDAAGEDSYSIVEPEIVRRYESELITA
KSLYTQQATLLQGLQEQSSEELRNSILTAYPDAQLDALVREYQTGQTTLANKSIDLGEGHPTIKSLRAALQSFEAQIENR
IQGILAGLDLRVKSSLAQVKELQKAVDNAKSKEAKIQEEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVE
IIDKADNPIRPVRPNITLNIVLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNTAVLGVIPQNVGSLVDEGEESPHA
EAYRVLRTNILFAGRQSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYFKVSNSIGLTNLL
LGQNTVEEVVQITDIPNLHFIPSGKLPSSSMGVLSSSKMKGFVADMKSRYDYVFFDAPPIMGVSDASVLASAVDLCVLVV
QYRKYPQLMTQRAKEMVTKVGGNLVGVVLNNINISQDSYYYYYSGYYYDNYYKSRENEEESLPEKGSDQEKSITNESADR
DGSVKPKY
>gnl|bykdb|A0A2D5VY59 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Pedosphaera sp] (length=727 residues).
MQSKPVPQQSDSKLHFLDYWRIIRIRKTVILAVFLLVVLTTALVTYILKPTYSSSVRIAIEKDSADITPLIGMQMSQQHD
PYWVLTEFEKIQSKVVLHPVIDALELRNRWMKRYNLKQPLTLNEAFNVLKKSIEVDQYRNTSLIEITAYSQDKEEAALIA
QEIAEQYKSVREVNLQSMANAGIDALKQQYADQNEKVRLKQADLDQLREELNISDIYSAEGSSIGMTTEPQIVLRLEQER
TVAEAKLIRFQTLFNELEAMTLDQLKNTILTAMPGNLRLTHLLNEYDTTRQALARLSAIHGPEHPERKSLYTLLEEIETQ
VTSEITGVLRGLQSQVNAAQNELNELTAAVENAKANDALKTAKYRPYFTAKRDLENLSKISDMIMIRILQETVDASLPTE
SIVEIYDPAEPNDEPVRPKKVLNIALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQALGAPVLGVIPQNVQSLLLEGPD
SPHAEAYRVLRTNILFSKKDPKFNALTVVSGGAGEGKSTTIFNLATIFAQNDSRVLIIDSDLRRPSLHKLVGVSNAVGLT
DFLLGQKSVEEVIQTTKLDNLHFLPSGKLPSSSMGILNSQQMKDFIQDVKTRYDYVFFDSPPIMGVSDASILASEVDMAI
LVIQYRKYPQAMTIRAKQMVEKVGGNLLGVVLNNINISQDSYYYYYSGYYYDYYSKQDDSEGGSSAQPKTKSSKTASRGD
VELKNKF
>gnl|bykdb|A0A2D5WGA5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=728 residues).
MDKLPKTDQSSDKLHILDYWRIIRVRFINIMLVFLLTALTTTLVTFLLDKTYMSQSRISIEKDTSDIAPLLGMQTGPTAF
DPYFIQTEFEKIQSQKVLDKVVEKCELEDKWKPANGDPLSDVNARKILEKSIDIRQYRNTSIIELRAYDRDPNLAQDIAQ
ALAEEYKNHRTSLQKERVKTGIDTLTNRMEKINIEITGMQGRVDRLRTDLGISDAAGEESYSIIEPEIVRRYESELITAK
GVHTTQSTLLEGLKAQSDEELRASILTAHPDAQLDALIRELHTGQQTLANQSIDLGEQHPRIKGLKKVVSTLEGQIDDRI
QGVLAGLELRVKSSKAQVEQLQRDVEEAKRRESDVREKGREYFDAKRELANTTRIRDTILFRIMQEEVDLALPKSSTVQI
IDDADLPEKPVKPNIPLNIALGMVVGLILGVGLAFFLEYLDTSVKTIDDVEHALGAAVLGVIPQNVGSLLDEGDESPHAE
AYRVLRTNILFAGRKDESQTTFSVVSGGAGEGKTTTMFNLAVVFAQQGDRVLIVDSDLRRPSMHRYLKVTNNTGLTNYLL
GQNTIEEVIQTTELPSLHFIPSGKLPSSSMGILSSAKMKEFVTEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCVLVVQ
YRKYPQLMTQRAKEMVTKVGGDLVGVVLNNINISQDSYYYYYSGYYYDYYYKSREKEEESGDAAKDGKKEPKLLAKADVG
GEDEKPKY
>gnl|bykdb|A0A2D6DVN8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseibacillus sp] (length=732 residues).
MRNGPERQTNASEAALHAVDYWQVLKNRYGVILLTFLLIFMTAAVITYVLPKKYESTALLQVNHSFIELDPLNGSVGQPM
TGASPSHAYIQNQFKIIESEKTLLRVVEQLDLPTRWNGFDRNMAVLKLKSILKTEQIRNTDHIEIRIRHQNRDDARDIAK
AIAKSYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYIEGVLTSGRMGQSEETILRTAEMQQF
TAEEKKGQLENQIAQLLTLRDEELIDFAEGLQLPGSQVPVLRARYQEGKVNIAALEASGLGRKHPSVEMAYIAQEKLSED
LKSSVVVLRELLKTQLNLVNGQLDKIKDRVEDRRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKT
PITILEEAKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIPTDVGVLHKQSGMS
PDAEAYRILRTNIEFNRNNPEDNSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFFDINNSVGLSN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMI
VVQHRKLPRNMLVRVKEAVENVGGHVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSADSDPVPSVGATASGTSAATESTVA
TSDEDKDEGLTY
>gnl|bykdb|A0A2D6W6F4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=738 residues).
MAKQSETKLHALDYWQVARNRYAVILLTFALVFMTALVIAYLRPSEYLGRVQIQVQREARDIEVFRETGSVGNLGSDQLP
YMTFMQTQFEIIQSRETLKEVIKNGVDSAGNLLDLKKSWGVPSDEDAYRILKRKVETQDVRGTDLIDIEVYDTDPNLAAD
IANAVADAYRTRRQEEEQSRAQKALALLDQQIKSQEGRLEKARNNMIELMEELNIVDLSLGEPVWLRGSQPNTGTASLVM
AAKQREFAAEEAIQNLRSTIKSLTQLEGAELIKSAVDLGVKNETLNSGWSEYQTLELSRAALIDSGVGVKHPKIVNIDSQ
LNLRMNQLLDAVETHKKALTTQLAMAEQQYENSKESKERTEKMSLQERKQNVRYIEAKKEYELSKEMLNGMQSQLAKETI
DSAGQRTPLVIHELAEPQDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIPKDIN
VLHKESGLSPDAEAYRILRTNIEFNRKNADANAITLVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFFN
INNSVGLTNYLTTDLXLEDVILQTAYENLYFMPSGILPADAAGILNSRRMSELIAXVKSRFDLVFIDSPPILGVSXASVI
SSEVXLTIIVIQHRKLPRGMLLRVKQAIQNVGGTALGVVLNNVDVRSDNXYQYYTSYYTYYAPRNLDPDMESGSIGSPKA
GSKLASNDQNNLSAEDKF
>gnl|bykdb|A0A2D6ZI96 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=728 residues).
MERNTGSDQSSDKLHILDYWRIIRVRIATILLVFLLTAITTTVVTVMLPSTYMSLSRIAVEKDTSDIAPLMGVQATQSSF
DPXFISTEFEKIQSQVVLDAVVESCELQEKWKEHYGGEELDEVRARKHLEKVIDVSQYRNTSIIELRAYDRDRGLAQEIA
QALASEYKNYRSSLQKKRVVAGIDKLRSRMTTINEEIGAMQANVDXLRVQLGISDAAGEDSYSIVEPEIVRRYESELITA
KGLYTQQATLLQGLQEQSVEELRESIMTANPDAQLDALIREYQTGQTTLANKSIDLGEGHPTIKSLKAALESLDQQIDNR
IKGILAGLELRVQSSLAQVXELQKAVDDAKAKEAKVQEEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVE
IIDKADTPLNPVRPNKPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNAAVLGVIPQNVGSLVDEGDESPHA
EAYRVLRTNILFAGRTSEXXTTFSVVSGGAGEGKTTTMFNLAVIFAQMGDRILVVDSDLRRPSMHRYFKVSNNIGLTNLL
LGQNTLDEVIQTSDSPNLHFIPSGKLPSSSMGVLNSAKMKEFVAEMKSRYDYVFFDAPPIMGVSDASVLASAVDLCVLVV
QYRKYPQXMTQRAKDMVVKVGGNLVGVVLNNINISQDSYYYYYSGYYYDYYYKSREGEEDAGEEKKADKDQKLVAQANPG
GSDVKPKY
>gnl|bykdb|A0A2D7B522 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Pedosphaera sp] (length=732 residues).
MESNNQHSMENQSVAENLNLRHYWHIVLERRWLVIVAFISVFILSILYLFKATPIYEAKTVLQINKESTSMMDGATPIVF
NSNDQEYLQTQYKNLLSRSLIESVVRDLGLDEEGRYAQSLDVINAVRNDITISPVRLSRLVEISVQHPSPRVAAQMSNKL
LDNFLARNLDQKRERAFQSYQWXDTEVDGLQEEVKNSRLAVFRFREKNKMPSLEESQDTVSKALFAASQSHQLANDEAEQ
AQKAIDEVDKMIREAGESGQLLDLSQIPFVASSEIIKTIRANLVMAKTDLAALQVKYLEKWPAVIEAKERIVKLTEEIQK
VAQDEIDLLREQARYQQARAVRALDSLNARQADMNRLNQLKVEYDNLVMQKMQSEELYTSMLAKTKEMDLSTKDMMQNLV
VVDKAFEPINPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYXPNIKTNSLVERDMQAHL
HPQSNAAEGFRTVRAAISLVHKADKFKVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAFQMQSPI
GISSYLTDQVSDIAEITQKTEVPNLDIICCGAVPNNPSELVGSTRMGELLEAVRGKYDRIFVDCPPVSAVSDPLMIASRS
DGIVFVSKFNKIRRDHARKTIQRIQDAGIYILGTVINDIDFEGKDSYYYSYYYYQNRYYASYYSNEKKLEPNKKSKSVVQ
LDKTAKKSESEV
>gnl|bykdb|A0A2D7B5P5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Pedosphaera sp] (length=730 residues).
MQTKPSQQPQQQSXSKLHFLDYWRIIRIRKTVILAVFLLVVLTTAIITFLIQPTYASSVRIAIEKDNSDITPLMGLQAAQ
QHDPYWVLTEYEKIQSKKVIHPVINXLGLNHKWMERFKTDTPLTTNETFQVLKNSIDVDQYRNTSLIEIKAYSKDKEEAA
LIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLXQQNKVQTKQKDLDKLREDLNISDIYSAEGSSIGMTTEPQIVMKLE
QERTVAEANLIRYETLFKELTSLTLEELRNTLLTAMPGNLRLTSLLNEFDRGHQQLSQMKAIHGPDHPQMQASNSLLLTL
NDQIKKEITGVLRGLQTQVNAARNQLTELTSAVESAKASDAEKTAEYRPYFTAKRDLENLSKISDMIMIRILQETVDAAL
PTDSIVEIYDPAEPNPDPVRPKIFLNIALGVVVGLVVGIGXAFFIEYLDTSVKTIDDVEQALDAPVLGVIPQNVHSLLME
GPDSPHAEAYRVLRTNILFSRKXEKAXTLTVVSGGAGEGKSTTIFNLATVFAQNXSRILIVDSDLRRPSLHKHVGVSNAL
GLTDYLLATKSLEEVVQTTKHENLDFLPSGKLPSSSMGILNSSKMKSFIAEARKRYDYVFFDSPPIMGVSDASILASEVD
MAILVIQYRKYPQAMTVRAKQMVEKVGGNLLGVVLNNINISQDSYYYYYSGYYYDYYSKQDGDNTSSKKKSDGKSGKTSA
RGDLELKNKF
>gnl|bykdb|A0A2D7L1N4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=730 residues).
MDNTSGSEQSSEKLHILDYWRIIRVRIATILLVFLLTAITTTVVTFLIPPTYMSLSRIAVEKDTSDIAPLMGAQSSQSSF
DPYFISTEFEKIQSQIVLDAVVETCELREEWKDDNGGESLSELRARKLLEKVIDVSQYRNTSIIELRAYDGDENLAREIA
QALAEEYKKYRSNLQKGRVEAGINKLKERMEKTNNEISLMQAKVDSLRVTLGISDAAGEDSYSIVEPEIVRRYESELITA
KSLYTQQATLLQGLKEQGDEELRNSILTAYPDAQLDALVREYQTGQNSLANKSIDLGEGHPTIKSLRAVLSTFEGQIQNR
IKGILAGLELRVKSSLAQVNELQKAVDSAKSKEAKVQEEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVE
IIDKADNPIRPVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNTAVLGVIPQNVGSLVDEGEESPHA
EAYRVLRTNILFAGRQSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYFKVSNNIGLTNLL
LGQNTVEEVVQITDIPNLHFIPSGKLPSSSMGVLSSAKMKDFVADMKSRYDYVFFDAPPIMGVSDASVLASAVDLCVLVV
QYRKYPQLMTQRAKEMVTKVGGNLIGVVLNNINISQDSYYYYYSGYYYDNYYKSREDEEGSDGTGSDNKEIKDKSITTEV
DSSSDVKPKY
>gnl|bykdb|A0A2D8UZZ4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Pedosphaera sp] (length=727 residues).
MQSKPVPQQSDSKLHFLDYWRIIRIRKTVILAVFLLVVLTTALVTYILKPTYSSSVRIAIEKDSADITPLIGMQMSQQHD
PYWVLTEFEKIQSKVVLHPVIDALELRNRWMKRYNLKQPLTLNEAFNVLKKSIEVDQYRNTSLIEITAYSQDKEEAALIA
QEIAEQYKSVREVNLQSMANAGIDALKQQYADQNEKVRLKQADLDQLREELNISDIYSAEGSSIGMTTEPXIVLRLEQER
TVAEAKLXRFQTLFNELEAMTLDQLKNTILTAMPGNLRLTHLLNEYDTTRQALARLSAIHGPEHPERKSLYTLLEEIETQ
VTSEITGVLRGLQSQVNAAQNELNELTAAVENAKANDALKTAKYRPYFTAKRDLENLSKISDMIMIRILQETVDASLPTE
SIVEIYDPAEPNDEPVRPKKVLNIALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQALGAPVLGVIPQNVQSLLLEGPD
SPHAEAYRVLRTNILFSKKDPKFNALTVVSGGAGEGKSTTIFNLATIFAQNDSRVLIIDSDLRRPSLHKLVGVSNAVGLT
DFLLGQKSVEEVIQTTKLDNLHFLPSGKLPSSSMGILNSQQMKDFIQDVKTRYDYVFFDSPPIMGVSDASILASEVDMAI
LVIQYRKYPQAMTIRAKQMVEKVGGNLLGVVLNNINISQDSYYYYYSGYYYDYYSKQDDSEGGSSAQPKTKSSKTASRGD
VELKNKF
>gnl|bykdb|A0A2D8V0G3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Pedosphaera sp] (length=737 residues).
MEFQQSSQATETSVAENLNLRHYWHILLERRWLVITTFISVVILSVLYLYRAVPIYQAKTVLQINKESTSIMDVGSQVVF
NSNDQEYLQTQYKNLLSRSLIESVITDLELKQDEVFKGAENIVNAVRDCITISPIRLSRLVEVSVEHPSPLQAAAIANKL
MQNFLTRNLDKKKQRAFESYKWLQNEVNQLADDVRATRLSVFQFREDNQMPSLEESQNTLSQALFLASDGFQKASDEAAQ
AVKVVETVDNLIAEAEADSRTLDLSVLPYIQNSPIIQQLRVSLAAAEAELASLEVKYLEKWPAVIVAKEQIRKLTDEIQQ
QAGQELKILREQARFANERADRARVTYDEAQVAMNRLNELKVEYDNLVMEKEQSEQLYTAMLAKTKEMDLNTKDMMQNLE
VVDLAYEPFNPIKPRKALTLLLGLVGGLGMGFAFAFFANYLDDSVKSQDDIESYLKLNFLGYIPNIKSQSLVERDLQAHL
HPQSNAAEGFRTVRAAVSLVHKSDKFKVLSMTSTIPSEGKSLVASNLAIVTAQTGVKTLLIDADLRRPSMHKAFQMQSPI
GLSAYLTGQITDPSEITQTTEVPNLDLICCGAVPNNPSELVGSKRMGELLDSLRDRYDRIFVDCPPVSAVSDPLMVGART
DGMVFVSKFNKIRREHARKTVQRIQDAGIYILGTVINDIDFEGKDSYYYSYYYYQNRYYASYYSNEKKLGSKKGEGAKDG
ELVQGGKAGKDDEPSKA
>gnl|bykdb|A0A2D8Z5A8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=772 residues).
MGVFLFLVEKTSECSYFADSKFILNSPQIKYIXTMAKQSETKLHALDYWQVARNRYAVILLTFALVFMTALVIAYLRPSE
YLGRVQIQVQREARDIEVFRETGSVGNLGSDQLPYMTFMQTQFEIIQSRETLKEVIKNGVDSAGNLLDLKKSWGVPSDED
AYRILKRKVETQDVRGTDLIDIEVYDTDPNLAADIANAVADAYRTRRQEEEQSRAQKALALLDQQIKSQEGRLEKARNNM
IELMEELNIVDLSLGEPVWLRGSQPNTGTASLVMAAKQREFAAEEAIQNLRSTIKSLTQLEGAXLIKSAVDLGVKNETLN
SGWSEYQTLELSRAAXIDSGVGVKHPKIVNIDSQLNLRMNQLLDAVETHKKALTTQLAMAEQQYENSKESKERTEKMSLQ
ERKQNVRYIEAKKEYELSKEMLNGMQSQLAKETIDSAGQRTPLVIHELAEPQDVDKPARPNIKLHLVLGAAVGLIFGIGM
AFFLEYLDTSVKSLDEVEYYLDLPVLAVIPKDINVLHKESGLSPDAEAYRILRTNIEFNRKNADANAITLVSGGAGEGKS
TTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFFNINNSVGLTNYLTTDLKLEDVILQTAYENLYFMPSGILPADAAGILN
SRRMSELIADVKSRFDLVFIDSPPILGVSDASVISSEVDLTIIVIQHRKLPRGMLLRVKQAIQNVGGTALGVVLNNVDVR
SDNQYQYYTSYYTYYAPRNLDPDMESGSIGSPKPGSKLASNDQNNLSAEDKF
>gnl|bykdb|A0A2D9MYT1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=803 residues).
MXQXPFNESREEGLFEESINLRHYWHIVLERRWLVAATFLVVIILTAFYLFSATPIFSATTRLQIDRETENALRMESFVM
EGAREQDYLQTQYKNLQSRSLMEMALEETLQNAMILDGLKAGRRNPKQLIGETGLSETNVIERLHQISKAGFFGLTGYAG
GDAPALSREENRPLATGLFAFPPKPKDGEEPEDLTYEEQLKRLSDAVSVSPIRLSRLVDVSVESPNRNEAALIANTVISK
FLEQDNNRKRGKLANAVDFLREEATNLSTAVHTNYMALHNFKLEWDIISLEDSQNTTLQALLKAQTDYDAAHSRAVEAQA
SADEAQRVFTETGEFGTIPDVAADAEVKKMRGDLALALAELASLRERYLEKHPKIIEKRSSIEALQESLKNAENRIFDSI
MNKAKLAKATDVQLAGVLTIRKSEQQSMNQKSIEYNNLSRTATQSETMYNLALQRXKETELQEKDIVQNMHVIDLATAQM
HAIKPKKLLTAFLGIIGGLGAGFGLAFFVNFLDDSIKSQEDIETYLKLPFLGYVPNIKTTSIIERDLQAHLHPQSNSAEA
FRTVRAAISLSVRAGDLQILSVTSTVPSEGKSLVASNHAIVTAQTGAKTLLVDCDLRRPSVHKAFQIQSPKGLSSYLLGK
VDTIDSIVHQTEVANLDIICCGAVPNNPSELAGSQRMIDFVEEVRXKYEKIVFDCPPVSAVSDPLIIAANTDGTVFVNKF
NKIRREHARKTVQRVQDAGINIVGVCINDLDFEGKDSYYYSYYYYQNRYYASHYKSDKPXEEEAXQLPLQPGVKXAGKEE
XSA
>gnl|bykdb|A0A2E0PDQ1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=728 residues).
MDKTSGSEQSSDKLHILDYWRIIRVRIAIILVVFLLTAITTTVVTFLIPPTYMSLSRIAVEKDTSDIAPLMGVQAAQSSF
DPYFISTEFEKIQSQIVLDAVVSSCELREEWKDDNGGELLTELRARKRLEKVIDVSQYRNTSIIELRAYDGDENLAREIA
QALAEEYKKYRSNLQKRRVEAGINKLKERMEKTNEEISLMQAKVDSLRVKLGISDAAGEDSYSIVEPEIVRRYESELITA
KSLYTQQATLLQGLQDQDSEELRNSILTAYPDAQLDALVREYQTGQTTLANKSIDLGDGHPTIKSLRAALQSFEAQIENR
IQGILAGLELRVKSSLAQVNELQKAVDNAKTKEAKIQEEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVE
IIDKADNPIRPVRPNITLNIALGVIVGLILGVGFAFFIEYLDTSVKTIDDVERALNTAVLGVIPQNVGSLVDEGEESPHA
EAYRVLRTNILFAGRQSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYFKVSNSIGLTNLL
LGQNTVEEVVQITDIPNLHFIPSGKLPSSSMGVLSSSKMKDFVADMKGRYDYVFFDAPPIMGVSDASVLASAVDLCVLVV
QYRKYPQLMTQRAKDMVTKVGGNLVGVVLNNINISQDSYYYYYSGYYYDNYYKTRENEEESIAVKESDKDKLINTEATEN
NESVEPKY
>gnl|bykdb|A0A2E1RQR9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=738 residues).
MAKQSETKLHALDYWQVARNRYSVILXTFALVFMTALVIAYLRPSEYLGRVXIQVQRVARDIEVFRETGSVGNLGSEQLP
YMTFMQTQFEIIQSRETLKQVISKGKDSAGNPLDLKKAWGVNSDEDAYRILKKKVETQDVRGTDLIDIEIYDTDPKLAAD
IANAVADAYNIRRQEEEKNRATKALTLLDTQIKKQEGRXEAARNNMIELMEELNIVDLSLGEPVWLRGSQPNTGTASLVL
AAKQREFAAEEAIQNLRSTISSLTKLEGEELIKSAVDLGVKNETLTSGWTEYQSLELXRAALVDSGVGXKHPKILNXXSQ
LNLRMKQLLGAVETHKKALSTQLTMAEQQFENSRESKERTEKMSLQERKQNVRYIEAKKEYELSKEMLNGMXSQLAKETI
DKEGQRTPLVIHEQAEPSDVDKPARPNIKXHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIPKDVG
VIHKQSGLSPDAEAYRILRTNIEFNRKNADANSITLVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFFN
INNSVGLTNYLTTDLQLEDVILQTAYENLYFMPSGILPADAAGILNSRRMSELIADVKSRFDLVFIDSPPILGVSDASVL
SSEVDLTIIVIQHRKLPRGMLVRVKQAIQNVGGTALGVVLNNVDVRSDNQYQYYTSYYTYYAPRNLDPNMNSNSDDLFKS
GDKLASNDKDNLTAEDKF
>gnl|bykdb|A0A2E2R937 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=730 residues).
MDNTSGSEQSSEKLHILDYWRIIRVRIATILLVFLLTAITTTVVTFLIPPTYMSLSRIAVEKDTSDIAPLMGAQSSQSSF
DPYFISTEFEKIQSQIVLDAVVETCELREEWKDDNGGESLSELRARKLLEKVIDVSQYRNTSIIELRAYDGDENLAREIA
QALAEEYKKYRSNLQKXRVEAGINXLKERMEKTNNEISLMQAXVDSLRVTLGISDAAGEDSYSIVEPEIVRRYESELITA
KSLYTQQATLLQGLKEQGXEXLRNSILTAYPDAQLDALVREYQTGQNSLANKSIDLGEGHPTIKSLRAVLSTFEGQIQNR
IKGILAGLELRVKSSLAQVNELQKAVDSAKSKEAKVQEEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVE
IIDKADNPIRPVRPNIALNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNTAVLGVIPQNVGSLVDEGEESPHA
EAYRVLRTNILFAGRQSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYFKVSNNIGLTNLL
LGQNTVEEVVQITDIPNLHFIPSGKLPSSSMGVLSSAKMKDFVADMKSRYDYVFFDAPPIMGVSDASVLASAVDLCVLVV
QYRKYPQLMTQRAKEMVTKVGGNLIGVVLNNINISQDSYYYYYSGYYYDNYYKSREDEEGSDGTGSDNKEIKDKSITTEV
GGSSDVKPKY
>gnl|bykdb|A0A2E2ZZP9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=728 residues).
MDKTSGSEQSSDKLHILDYWRIIRVRIAIILVVFLLTAITTTVVTFLIPPTYMSLSRIAVEKDTSDIAPLMGVQAAQSSF
DPYFISTEFEKIQSQIVLDAVVSSCELREEWKDDNGGELLTELRARKRLEKVIDVSQYRNTSIIELRAYDGDENLAREIA
QALAEEYKKYRSNLQKRRVEAGINKLKERMEKTNEEISLMQAKVDSLRVKLGISDAAGEDSYSIVEPEIVRRYESELITA
KSLYTQQATLLQGLQDQGSEELRNSILTAYPDAQLDALFREYQTGQTTLANKSIDLGDGHPTIKSLRAALQSFEAQIENR
IQGILAGLELRVKSSLAQVNELQKAVDNAKTKEAKIQEEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDLDLPKESSVE
IIDKADNPIRPVRPNITLNIALGVIVGLILGVGFAFFIEYLDTSVKTIDDVERALNTAVLGVIPQNVGSLVDEGEESPHA
EAYRVLRTNILFAGRQSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVIDSDLRRPSMHRYFKVSNSIGLTNLL
LGQNTVEEVVQITDIPNLHFIPSGKLPSSSMGVLSSSKMKDFVADMKGRYDYVFFDAPPIMGVSDASVLASAVDLCVLVV
QYRKYPQLMTQRAKDMVTKVGGNLVGVVLNNINISQDSYYYYYSGYYYDNYYKSRENEEEPIAEKESDKDKLINTEDAEN
NESVEPKY
>gnl|bykdb|A0A2E3EC33 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=738 residues).
MAKQSETKLHALDYWQVIRNRYTVILLTFFLVIMTAAVIAYLRPPEYLGRVQIQVQREARDLEVFRETGSVGNLGTESLP
YMTFMQTQFEIIQSRETLKEVINNGKDSLGQPLDLXAKWGLTSEEDAFXILKKKVETQXVRGTDLIDIEVYDTDAQLAAD
IANALANAYQARRQNEEKERADTALEKLDTQIMAQMTRLEKARDMMINLMEELNIVDLSLGEPTWLRGSQPNTGIASLVM
TAKQKEFQAEGAIQNLRTTIKSLTDLEGEELIKSAVDLGIKNETLSSGWSSYQALELSRAALVESGVGNKHPKIINIDSQ
LALRMKQLLDAVDVHKKALETQLSMAEQQFQNSKETKERTEKASLKERKDNVRYIEAKKEYELCKEMLNGMQSQLAKEKI
DAAGQRTPMVIHEIAEAADPGNPARPNIKLHLVLGATVGLVFGIGMAFFLEYLDTSVKSMDEVEHFLELPVLAVIPQAVG
VLXRQSGLSPDAEAYRILRTNIEFNRKTADANSMTIVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDADLRRPQLHTFFN
XNNSVGLTNYLTTDLALEDVILQTAYENLYFMPSGILPSDAAGILNSRRMSELIADVKSRFDLVLVDSPPILGVSDASVL
ASEVDLTIIVIQHRKLPRGMLIRVKQAIENVGGKALGVVLNNVDVRSDNQYQYYTSYYTYYSPSNIDPNQKISSDKPKAP
SSKEPKGSSEEISIEDKF
>gnl|bykdb|A0A2E3H787 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseibacillus sp] (length=732 residues).
MRNGPDRQTSASEAALHAVDYWQVLKNRYGVILLTFLLIFMTAAVITYVLPKKYESTALLQVNHSFVELDPLNGAAGRPM
TGASPSQAYIQNQFKVIESEKTLLRVVERLDLTTRWRGFDRDMALLKLKSILKTEQIRNTDHIEIRIRHQKQEDARDIAK
EIAESYQLGRNADERKRAEEALDALESEVRSQEDLVEDRRRHFHAIVKAVGIPYIEGIXTSGRMGQSEENILKTAEMQQF
AAEXKKXXLENQIERLLTLKDAELIDFAEGLQLPGSQVPVLRGRLQESKVNIAAXEASGLGRKHPQVEMGLIAQAKIEED
LKAAVVVLRELLKTQLSLVXGXLEKIKDRVEDRRFDAVXKAXQSQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKN
PITILEDPKLGKXPVYPKVTLFLSLGAAVGLIFGVAIAFFLEYLDTSVKTLEDVERYLQIPVLAVVPTDVNVLHKQSGMS
PDAEAYRILRTNIEFNRNNPEDNSITVVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPQLHTFFDINNSVGLTN
YLTTDLMLEDVILQTPVDNLYXLPSGILPADAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMI
VVQHRKLPRNMLLRVXQAVENVGGQVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSADADPVPGAGFEAAAESATAEATGS
SKDENDDDGLTY
>gnl|bykdb|A0A2E3II01 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseibacillus sp] (length=732 residues).
MRNGPERQTNASEAALHAVDYWQVLKNRYGVILLTFVLIFMTAAVITYVLPKKYESTALLQVNHSFIELDPLNGSVGQPM
TGASPSHAYIQNQFKIIESERTMSRVVERLDLPTRWNGFDRNMALLKLKSILKTEQIRNTDHIEIRIRHQNRDDARDIAK
AIAESYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYIEGVLTSGRMGQSEETILRTAEMQQF
TAEEKKGQLENQIAQLLTLRDEELVDFAEGLQLPGSQVPVLRARYQESKVNIAALEASGLGRKHPSVEMAYISQKKLSED
LKSSVVVLRELLKTQLNLVNGQLEKIKDRVEDRRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKT
PITILEEAKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIPTDVGVLHKQSGMS
PDAEAYRILRTNIEFNRNNPEDNSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFFDINNSVGLSN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMI
VVQHRKLPRNMLVRVKEAVENVGGHVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSADSDPVPTVGTTASGTSAAIESAVA
ATDADKDEGLTY
>gnl|bykdb|A0A2E3ISQ4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiaceae bacterium] (length=738 residues).
MAKQSETKLHALDYWQVARNRYAVILLTFALVFMTALVIAYLRPSEYLGRVQIQVQREARDIEVFRETGSVGNLGSEQLP
YMTFMQTQFEIIQSRETLKEVIKNGENSAGNLLDLKKSWGVPTNEDAYQILKRKVETQDVRGTDLIEIEVYDTDPNLAAD
IANAVAKAYKIRRQRVEKERADTALALLDLQIQQQEKRLEDARSVMIKLMEDLNIVDLSLGEPVWLRGSQPNTGTASLVM
AAKQREFAAEEAIQNLRSTIKSLTQLEGAELIKSAVDLGVKNETLNSGWSEYQTLELSRAALIDSGVGVKHPKIVNIDSQ
LKLRMNQLLDAVETHKKALTTQLSMAEQQYENSKESKERTEKMSLQERKQNVQYIEAKKEYELSKEMLNGMQSQLAKETI
DSAGQRTPLVIHEEAEPQDVDKPARPNIKLHLVLGAAVGLIFGIGMAFFLEYLDTSVKSLDEVEYYLDLPVLAVIPKDIN
VLHKESGLSPDAEAYRILRTNIEFNRKNADANSITLVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGDLRRPQLHTFFN
INNSVGLTNYLTTDLKLEDVILQTAYENLYFMPSGILPADAAGILNSKRMSELIADVKSRFDLVFIDSPPILGVSDASVI
SSEVDLTIIVIQHRKLPRGMLLRVKQAIQNVGGTALGVVLNNVDVRSDNQYQYYTSYYTYYAPRNLDPNMESDSIGSTKS
ESKVASNDQNNLSAEDKF
>gnl|bykdb|A0A2E3NAY6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseibacillus sp] (length=732 residues).
MRNGPERQTNASEAALHAVDYWQVLKNRYGVILLTFLLIFMTAAVITYVLPKKYESTALLQVNHSFVELDPLNGSVGQPM
TGASPSHAYIQNQFKIIESERTMSRVVERLDLTTXWNNFDRNMALLKLKSILKTEQVRNTDHIEIRIRHQNRDDARDIAK
AIAESYQEGRNEDERKRAGDALDALEAEVRSQEDLVEDKRRHFHSIVRAVGIPYIEGVLTSGRMGQSEETILRSAEMQQF
TAEEKKGQLENQIAQLLTLRDEELIDFAEGLQLPGSQVPVLRARYQESKVNIAALEASGXGRKHPSVEMAYIAQEKLKED
LKSSVVVLREXLXTQLNLVDGQLEKIKDRVEDRRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKT
PITILEDPKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVVPTDVGVLHKQSGMS
PDAEAYRILRTNIEFNRNNPEDNSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFFDINNSVGLSN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMI
VVQHRKLPRNMXVRVKEAVENVGGHVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSADSDPVPTGGTTSSGTTEAIESTVA
TNDADDDEGLTY
>gnl|bykdb|A0A2E4GN01 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiaceae bacterium] (length=738 residues).
MAKQSETKLHALDYWQVVRNRYSVXLLTFFLVXMTAMVIAYLRPPEYLGRVQIQVQREARDLEVFRETGTVGNLGSESLP
YMTXMQTQFEIIQSRETFKEVINNGKDSLGRPLXLMEEWGVSSEDDAFRXLKKKVETQDVRGTDLIDIEVFDTDAQLAAD
LANALAXAYQXRXQNEEKXRADKALEXLXTXIXAQMTXXEXSRDMMIGLMXELNIVXLSLGEPTWLRGSQPXTGXASLVM
TAKQKEFXAEXAIQXLXTTIXSLTDLKGEELIKSAVDLGIKNDILSNGWSSYQTLELSRAALVESGVGKKHPKILNIDKQ
LKLRMMQLLDAVEVHKKALQTQLSMAEQQFQNSKETKERTEKASLKERKDNVRYIEAKKEYELSKEMLNGMQSQLAKEKI
DAAGQRTPMVIHEKAEASDPDNPARPNIKLHLVLGAAVGLVFGIGMAFFLEYLDTSVKSLDEVEHFLELPVLAVIPQDVG
ILHRQSGLSPDAEAYRILRTNIEFNRKTSDANSMTIVSGGAGEGKSTTLVNLAYVCAQGGYNTLMIDGDXRRPQLHTFFN
INNSVGLTNYLTTDXALEDVILQTAYENLYFMPSGILPSDAAGILNSRRMSELXADVKSRFDLVLVDSPPILGVSDASVL
ASEVDLTIIVIQHRKLPRGMLIRVKQAIENVGGKALGVVLNNVDVRSDNQYQYYTSYYTYYSPSNMDPNQKISSDKTKSS
SSKESKSSSEEISAEDKY
>gnl|bykdb|A0A2E5EPT8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=732 residues).
MEYQSNGPTSSDNRLHFLDYWRILRLRKGVIFVNFIFVVLVATFVTYLLPKTYKSTVRMDVKKDTASDIELLGGTPQGPD
FDPFFILTQFERLQSAEVLYPVIEKMNLGRVWGARYGIGEFTPQKTKLLLEKRIDPTQVRNTSIIALTVYSEDKKEAAEI
ANTIAKVYAETREQNRITQVRKGIAKMREKLGEASNSVVQAQADVQRVREELKFDVIMETPGKVALALDSERVRALEMLN
IEMNAGLTSKKTQLEQLKSLSPKVLGNALMTVLPNEINLPRLYEQLATAQQELVAKGKELGPKNPEIERMTKVILEIQLQ
IEGRVKGIMSGLEAEAKALQSGYDNRMTQLDKAREQNRTAAENGQRYMDVQKKLERLERIRDTIELKIESEEIDADIGRT
AAVEVIDPAEPAIRPAKPKVALNIALGVVLGAVMGIGMAFFIEYLDTSVKTIDDVEHTLQAPVLAVIPQNVGVLMNEDPD
TPHAEPYRVLRTNILFTNKKPNANTITVVSGGAGEGKSTTVLNLATIFAQNGNRVLLVDSDLRRPSLHKRLDIENSPGLT
DYLLGQGKLEDVIQKTDQADLDLLPSGKLPSSAMGILNSQQMRDFVKEVQSRYDFILLDSPPLMGVSDATVLTSMVDLTL
LVIQYRKYPQSLAVRSRQMIEKVGGTLLGIVLNNINVSSDASYYYYSGYHYHDNPSSSGSLNIDSKPRELKGKVDRQRGQ
DSSEEPDLKSKY
>gnl|bykdb|A0A2E5QMS4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseibacillus sp] (length=732 residues).
MQNDPDRQTAASEASLHAVDYWQVLKNRYGVILLTFLLIFMTAAVITYVLPKKYESTALLQVNHSFVELDPLNGAAGHPM
TGASPSHAYIQNQFKIIESEKTMLRVVERLDLTTRWRGYDRDMALVKLKQILKTEQIRNTDHIEIRIRHQNSEDARDVAK
EIAESYQXGRNADERNRAGEALDALEAEVRSQEDLVEDKRRHFHSIVKAVGIPYIEGVYSSGRMGQSEEYILKSAEMQQF
GAEERKAELENQIQQLLTLRDDELIDFAEGLKLPGSQVPVLRARIQESKLNMAAMEASGLGRKHPSMEMSLIAQNKMQED
LGGAVVVLRELLKTQLRLVNGQLAKIKERVEERRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKN
PITILEDPKMSKNPVYPKVTLFLSLGAAVGLIFGISIAFFLEYLDTSVKSLEDVERYLQVPVLAVIPKDVGTLHKQSGMS
PDAEAYRILRTNIEFNRNNPEDNAITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDSDLRRPTLHTFFDINNSVGLTN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGILNSRRMSELVQDVKQRFDLILVDSPPILGVSDASVLASEVDLTIV
VVQHRKLPRNMLMRVKAAVENVGGQVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSSDVDPISSPPRKMTVSTGASPTATP
STPEEDDDGLSY
>gnl|bykdb|A0A2E5XJ49 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiaceae bacterium] (length=730 residues).
MQNDLDRQSAASEASLHAVDYWQVLKNRYGVILLTFLLIFMTAAVITYVIPKQYESTALVQVNHSFVELDPLNGVAGAPM
TGASPSHAYIYNQFKIIESEKTLARVVERLDLTTRWSGYDRDMALLKVKKILKTEQIRNTDHIEIRIRHQKPEDAQLIAQ
EIAKSYQLVRNADERARAGEALDALEAEVRSQEDLVEDKRRHFHTIVKAVGVPYIEGVFPSGRMGQSEEEILKMAVMQQF
EHEKSKRQLENQINQLVNLKNEELMNFAEGLKLPGSAVPELHRAWMAGKRSIATMEASGLGRKHPNIRMALIAQDKLEED
LRSAVVTLKDLLRTQLELVDGQLEKLRQVVEESRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKITNSARRIALKIPKN
PITILEEPKQAKDAVYPKVSLFLGLGAAVGLIFGVAIAFFLEYLDTSVKSLEDVERYLQVPVLAVIPKDVGVLHKQSGMS
PDAEAYRILRTNIEFNRKNPEDNAITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFDINNSVGLTN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGILNSRRMSELIEDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMI
VVQHRKLPRNMLLRVKQAVENVGGQVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSADPDPVAGGSPGGPPGGGSRTVSTS
APQDEDEALY
>gnl|bykdb|A0A2E6HCR0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=728 residues).
MDNNSGSEQSSDKLHILDYWRIIRVRIATILLVFLLTAITTTVVTFLIPPTYMSISRIAVEKDTSDIAPLMGVQTAQSSF
DPYFISTEFEKIQSQIVLDAVVRSCELRDEWKDDNGGEPLTELVARKRLEKVIDVSQYRNTSIIELRAYDGDEDLAREIA
QALAEQYKNYRSNLQKRRVEAGINKLKERMEKTDEEISVMQAKVDDLRVKLGISDAAGEDSYSIVEPEIVRRYESELITA
KGLYTQQATLLKGLKEQSFENLRESILTAYPDAQLDALVREYQTGQTTLANKSIDLGEGHPTIKSLRAALQSFDSQIQNR
IQGILAGLELRVSSSLAQVNELQMAVDDAKSKEAKVQEEGREYFDAKRRLSNTTRMRDTILFRIMQEEVDLDLPKESSVE
IIDKADNPIRPVRPNIPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNAAVLGVIPQNVGSLVDEGEESPHA
EAYRVLRTNILFAARKSEDQTTFTVVSGGAGEGKTTTMFNLAVIFAQLGDRILVVDSDLRRPSMHRYFKVTNSIGLTNLL
LGQNTLDEVIQTTDIPNMHFIPSGKLPSSSMGVLSSSKMKDFVADMKSRYDYVFFDAPPIMGVSDASVLASAVDLCVLVV
QYRKYPQLMTQRAKDMVIKVGGDLAGVVLNNINISQDSYYYYYSGYYYDYYYKSRENEEESEDVKESENGKSLVSEAASD
REDVKPKY
>gnl|bykdb|A0A2E6SBY8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseibacillus sp] (length=731 residues).
MQNDPDRQPAASEASLHAVDYWQVLKNRYGVILLTFLLIFMTAAVITYVIPKQYESTALVQVNHSYIELDPLNGAAGPPM
TGASPSHSYIQNQFKIIESEKTLARVVERLDLXTRWSGYDRDMALLRVKKILKTEQIRNTDHIEIRIRHQKPEDAQLVAR
EIAKSYQLVRNSDERARASEALDALEAEVRSQEXLVEDKRRHFHAIVKAVGVPYIEGVFPSGRMGQSEEEILKMAVMQQF
EHEKAKRQLENQINQLVSLKNEELMNFAEGLKLPGSAVPELHRAWMAGKRSIATMEASGLGRKHPNIRMALIAQDKLEED
LRAAVVTLKDLLRTQLELVDGQLENLRKVVEESRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKITNSARRIALKIPKN
PITILEDPKQAKDAVYPKVSLFLGLGAAVGLIFGIAIAFFLEXLDTSVKSLEDVERYLQVPVLAVIPKDVGVLHKQSGMS
PDAEAYRILRTNIEFNRKNPEDNAITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPRLHTFFDINNSVGLTN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGILNSRRMSELIEDVKQRFDLILVDSPPILGVSDASVLASEVDLTMI
VVQHRKLPRXMLLRVKQAVENVGGQVIGVVLNNVDVRSDSQYQYYTSYYTYYAPTADADPVPXASPGGASAGRVRSAAAS
PSSQDDDGGLY
>gnl|bykdb|A0A2E6T482 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=727 residues).
MDKIPTTDQSSDKLHILDYWRILRVRFVTILLVFLLTAVTTTVVTFLLPRTYMSLSRISVEKDSSDIAPLLGMQAGPTAF
DPYFIQTEFEKIQSQKVLDKVVEKCDLTNKWDPNEKGLDLIKAREILKKTIDVRQYRNTSIIELRAYDRDKELATKIAQS
LAEEYRGHRSSLQKQRVGEGIKALNRRMEEINKKITGLQGNVDRMRTELGISDAAGEESYSIIEPEIVRRYESELITAKG
IHTTQATLLEGLKAQSREELRASILTAHPDAQLDALIRELHTGEQTVANQSIDLGEQHPRIKGLKKVVATLEGQIDDRIK
GVLAGLELRVKSSKAQVEELQRDVDEAKQRESDMREKGREYFDAKRELANTTRIRDTILLRIMQEEVDLELPTESTVEII
DDADXPDKAIKPNIPLNISLGVVVGLILGVGLAFFIEYLDTSVKTIDDVERSLGAAVLGVIPQNVGSLLEEGDESPHAEA
YRVLRTNILFAGRKSEDQTTFSVVSGGAGEGKTTTMFNLAVVFAQQGDRCLIVDSDLRRPSMHRYLQVSNNIGLTNYLLG
QVXIDEVIQTTQIPSLHFIPSGKLPSSSMGILSSSKMREFVSEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCVLVVQY
RKYPQLMTQRAKEMVTKVGGDLVGVVLNNINISQDSYYYYYSGYYYDYYYKSREKEEENADKSEDGAKEGKLLAKADLGA
GEDKPKY
>gnl|bykdb|A0A2E7AGN1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseibacillus sp] (length=732 residues).
MRNGPESQTNASEAALHAVDYWQVLKNRYGVIILTFLLIFMTAAVITYVLPKKYESTALLQVNYSYIELDPLNGSVGQPM
TGASPSHAYIQNQFKIIESEKTLSRVVETLDLTTRWSGFDEDMALIKLKSILKTEQIRNTDHIEIRIRHQNREDAQAVAK
AIAESYKDGRNKEELKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYIEGVLTSGRMGQSEETILKTAEMQQF
TAEEKKGQLENQIEQLLTLRDEELIDFAEGLQLPGSQVPVLRSRFQESKVNIAALQASGLGRKHPSVEMALIAQEKLQED
LKASVVVLRELLKTQLDLVNGQLVKIKDRVEDRRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKT
PITLLENPKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERYLQVPVLAVIPTDVGVLHKQSGMS
PDAEAYRILRTNIEFNRSNPEDNSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPTVHTFFDINNSVGLSN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMI
VVQHRKLPRNMLMRVKQAVENVGGYVVGVVLNNVDVRSDSQYQYYTSYYTYYAPSADADPVPGGGVTKSAERASVKTPGG
KNETDDEEGLTY
>gnl|bykdb|A0A2E7AKY7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseibacillus sp] (length=732 residues).
MRNGPESQTNASEAALHAVDYWQVLKNRYGVIILTFLLIFMTAAVITYVLPKKYESTALLQVNYSYIELDPLNGSVGQPM
TGASPSHAYIQNQFKIIESEKTLSRVVETLDLTTRWSGFDEDMALMKLKSILKTEQIRNTDHIEIRIRHQNREDAQAVAK
AIAESYKDGRNKEELKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYIEGVLTSGRMGQSEETILKTAEMQQF
TAEEKKGQLENQIEQLLTLRDEELIDFAEGLQLPGSQVPVLRSRFQESKVNIAALQASGLGRKHPSVEMALIAQEKLQED
LKASVVVLRELLKTQLDLVNGQLVKIKDRVEDRRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKT
PITLLENPKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERYLQVPVLAVIPTDVGVLHKQSGMS
PDAEAYRILRTNIEFNRSNPEDNSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPTVHTFFDINNSVGLSN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMI
VVQHRKLPRNMLMRVKQAVENVGGYVVGVVLNNVDVRSDSQYQYYTSYYTYYAPSADADPVPGGGVTKSAERATVKTPGG
KNELDDEKGLTY
>gnl|bykdb|A0A2E7SSH2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=727 residues).
MERKPGTEHSSDKLHILDYWRIIRVRIATILLVFLLTAITTTAVTFLIPATYMSLSRIAVEKDTSDIAPLMGMQATQSSF
DPYFISTEFEKIQSQVVLDEVVKKCDLKKRWKELYKWDLNDQQARKQLEKVIDVSQYRNTSIIELRAYDGDKQLAQEIAQ
ALAEAYEEYRQSLQQKRVQAGIDKLKERMEKTNEEISSMQSNVDALRAKLGISDAAGEDSYSIVEPEIVRRYESELITAK
GLYTQQATLLQGLQGQSPDELRESIMTAHPDAQLDALIREFQTGQTTLANKSIDLGEGHPTIKSLKAALDSLNQQIDNRI
SGILAGLELRVNSSLAQVQELQKSVDDAKAKEAKVQEEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDLDLPKTSSVEI
IDKADIPLRPVRPNKPLNIALGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALDAAVLGVIPQNVGSLMDEGDESPHAE
AYRVLRTNILFAGRQSEDQTTFSVVSGGAGEGKTTTMFNLAVVFAQMGDRILVVDSDLRRPSMHRYFKVTNNIGLTNLLL
GQNTLDEVIQTSDSPNLHFIPSGKLPSSSMGVLNSSKMKEFVAEMKSRYDYVFFDAPPIMGVSDASVLASAVDLCVLVVQ
YRKYPQLMTQRAKDMVIKVGGNLVGVVLNNINISQDSYYYYYSGYYYDYYYKSRETEEESTEDNKNGGNDKLIAQADIGG
DDVKPKY
>gnl|bykdb|A0A2E7YXQ3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseibacillus sp] (length=732 residues).
MQNDPDRQTAASEASLHAVDYWQVLKNRYGVILLTFLLIFMTAAVITYVLPKKYESTALLQVNHSFVELDPLNGAAGHPM
TGASPSHAYIQNQFKIIESEKTMLRVVERLDLTTRWRGYDRDMALVKLKQILKTEQIRNTDHIEIRIRHQNSEDARDVAK
EIAESYQLGRNADERNRAGEALDALEAEVRSQEDLVEDKRRHFHSIVKAVGIPYIEGIYSSGRMGQSEEYILKSAEMQQF
GAEERKAELENQIQQLLTLRDDELIDFAEGLKLPGSQVPVLRARIQESKLNMAAMEASGLGRKHPSMEMSLIAQNKMQED
LGGAVVVLRELLKTQLRLVNGQLAKIKERVEERRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKN
PITILEDPKMSKNPVYPKVTLFLSLGAAVGLIFGISIAFFLEYLDTSVKSLEDVERYLQVPVLAVIPKDVGILHKQSGMS
PDAEAYRILRTNIEFNRNNPEDNAITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDSDLRRPTLHTFFDINNSVGLTN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGILNSRRMSELVQDVKQRFDLILVDSPPILGVSDASVLASEVDLTIV
VVQHRKLPRNMLMRVKAAVENVGGQVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSSDVDPISSPPRKMTVSTGASPTATP
STPEEDDDGLSY
>gnl|bykdb|A0A2E8M146 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseibacillus sp] (length=733 residues).
MPNGPERQTNASEAALHAVDYWQVLKNRYGVILLTFLLIFMTAAVITYVLPKKYESTALLQVNHSFIELDPLNGSVGQPM
TGASPSHAYIQNQFKIIESETVLNRVVESLDLTTRWNGFDQNMALLKLKSILKTEQIRNTDHIEVRIRHQNRDDARNIAK
AIAESYKEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHAIVKAVGIPYIEGVLTSGRMGQSEEAILKSAEMQQF
TAEEKKGQLENQIEQLLTLQDEELIDFAEGLQLPGSQVPVLRGRYQESRVNIAALEASGLGRKHPSVEMAYIAQSKLQED
LKSSVVVLRELLKTQLSLVNGQLVKIKDRVEDRRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKT
PITILEHPKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIPTDVGVLHKQSGMS
PDAEAYRILRTNIEFNRNNPEDNSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFFDINNSVGLSN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMI
VVQHRKLPRNMLVRVKQAVENVGGHVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSADSDPVPTVGATASATSGSALESKV
VANDSEEDEGLNY
>gnl|bykdb|A0A2E8MCT7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=689 residues).
MAKLRSAPGPVDSYYQETKADIKKSPGVFDLAYLLPRLIARWHWILIGILLGVVLGVINIRMSVPEYRSTATVRVKSQNS
GSMGNSSESEDIDLQGLEAVEDIRSDFDRTELFLAVASDPTVRNLANLIPPDPPSIMGIFTAKEPVKKKVFADAPEPEQL
SGMISGWTSSEVRRGLRLIDISVNHTDPDVAQVIANQIVKQFINIREGVNEEGKKSDLQHLLAAAKERESELETARRRAG
SYTPALEAEKEMAVAEKAVQDLSIRYGPKHPKIISATDHIDLKTKILLSAMMDVLSNDLETDYWRGFQDQIDDIKNEENF
RELRNAMKLRASLLTNSVETKNELYNTLLSRVGVLKTDAEGVEAEVIKHEDAPRAWAPFSPNRKKIMVKTTMLGLCGGLA
LAFMFQFVDNKIHGVADIEQTFGISILSAIQKLPPEEELLKEMESIRDLPVSMKHICPTLAVPGWKTDFVHSEMFRVLRA
SISLLGDTNQRKITMITSSVPGEGKTFCAANLALAYAKQGTRTLLVDFDLRKPAVHKIFNEERAARPGIVNVLNGTAAAN
QAITVYPGLDTLSVIYSGPKSPNPGELLEPGRLRDLVEMFSSNFDHIVIDSAPLLPVPDTRILAPLVDNLALVIRAEHTP
VKSIQRAFDMLEDDGVFSSGVILNDFTENRLQGGKYGYGYGYGHYGDDT
>gnl|bykdb|A0A2E8MEZ0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=722 residues).
MQGTNFRNADDAPSVDYWQVVKNRYGVILLTFLLVFMTAAVITSVMPRKYESSSVVQVHPSVLLMTPFLGGSQMTPGSTM
TARYMENEFETITAPETLAEAAENIDLPRRWGLDMDSAIKTLENVVETIPIRGTDFIEITVTHANPEDAKEIAEAVSQAY
IERRNSTEEGRAQEALEALNQELQDQGDLVQDYRKALTVLIQQYGIPYFDGRDSGQVGQAEELMYRRAQEKLDTLEQTRD
QIQIQIRKLIDTPNEDLIRTAAGLELPENQVTSYYTGYRAADEQVSAMIASGLGPNHPEVKAMRLRADGALENAGKEVMS
LKEVLETRLNLVDKQVEKMKQMVREKKDGTVDLSMRQHQYNSAKEEYEQSRMMYREMSVKQQQQRVLLKMPRTPITLHER
AKKAKAPAYPNVTLNLLLGAGVGLIFGIGIAFLLEHLDTSVKSLEDVERYLQVPVLAVIPKDVGVLHKQSGMSPDAEAYR
ILRTNIEFNRKNPEDNSITVVSGGAGEGKSTTLVNLAYVCSQGGYTTLMVDADLRRPRLHSFFDINNSVGLTNYLTTDLA
LEDVILQTPVDNLYFLPSGILPADAAGILNSRRMSELLQDVKQRFDLVLVDSPPILGVSDAAVLASEVDLTMVVVQHRKL
PRNMLLRVKQAVENVGGQVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSSLEETGTPQQMTAAPASSKTEEKKSERSSSED
LY
>gnl|bykdb|A0A2E9IN28 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Puniceicoccaceae bacterium] (length=764 residues).
MKNDYVRGGADPNTGGYGGYGYGYGYGGGYGYGGYGAGGGYGEGGGGAPQRSFKDYFLMFRERIWYLIVAFFIIFSGSIL
YTFNKTKIYTAAAQVQLFRDDASALGKGAEMEQNQIRGAEDLNTQISVMESATIIKGVEQRLQDEMRERFMAPYTDALSL
SGPLTPLEILGRNRSIMPKRMSLMIHIAYSHPDPIVAAEVANLFAKEFIDYNLKLNIDGSMKAVEDLRIRADQQKERVEE
LELKLAEYREENNAVSLQSDENIAGAQLARLNEIKLSNKNLYDQLETKWNLIESYRRQGKELWELSFISEQPRVSSLLQR
ISGTRISISSLSKRYREKHPAMIQLLQTLQESEQELAIAVKNSVDKIYASYSEAKSNFELASQRLAEKEQELIDLSKTRI
EYNSLLRDLSVQQNFFQALNSRMTTEKAQVNLKNPNARIVDEAFPPSEDNPSSPNVTMNLAAGFFGGIAVGVGLIFVVAF
LDDRVKSAFDIEGTIGLPMLGVVPRIKKLDSNTKAQAVASNVDRHVTETFRTIHSALKLNDESKNAKIILTTSTVPSEGK
SFVSSNLSLTFANHGEKTLLIDCDLRLPNVARSLQLENDFGVLDHIDKGVDLDEVIIKEVYPNLDVLPTGGKSKNPTQVL
NSARFEAMFADLRDRYDRIVVDSPPLAAVSDALNLLPLVDGILYVIKFNTVKRKTAVVNVRRLWESNTPVFGAILNNITS
SLSSYYYSNYSDKAYQDYYIHHEEELEEEMAGSVEPQSELGPKA
>gnl|bykdb|A0A2E9ISN4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Puniceicoccaceae bacterium] (length=757 residues).
MQIPNSTISESKPPTPADNDRETTTAFSNPWALVQLIFRHWSWLVCSVVLCTLLGGLYAYLATPIYRATARIEILNDSRV
ETRATTQYDRQERSLSRQMLLLNSNRLHQQVRANLAEEWKKKLTEPERYVEFLVTSVPGSNGTMIDCLVDSVAAEYSKAY
LVEMIQGYRSLRMEELMEVNQSALLGLKNEETRVLEDLEQAKQDLETFERENQILFEKERADMDIAFVNQLLARLKSVRL
ERVLLENQYEQLSDADILTVNEALAATRETEGRSQVTPEGAPAVDPGAETPPEAAKNYGAYDHLNTGIQWQETQVRLDEL
QNEYKQLAAVFKDTHPRMIDLKGEITKAQSSLAHQNELALKRFEAHYEALKLQEAGIESVLNNWRSEQFLSVANQSEYKQ
LSSKVAHFERKYNLVYGRLLENTGTTEPFFLRKIQAPQASEKPIKPQVIKIIAASLFLGAAFGAGAILGLEYLKPNPINV
THLEREYHIDLLGQIRRWDLYLPIDKFNPESDIFVAAKGTNQIATETYRRIRLNLLKQFGQDENISFTVTSSQSGDGKTF
NVANIALPFAWVGKRVLLIDADLRLGNLTRRLLGRELRHGLADWLADDSCDANIHIVKLKHEPISILPAGVFDDSLPEKV
NAARLRGLVHSLQQDYDVIIIDTAPVSIFSESLAFCQATGGVLVMMDSLTSQASVQNCLNELRGIRTLGFCVNGVNESYL
RSNGYDAYGSYGTRHIESAFLYGMESETPKNKRWKFR
>gnl|bykdb|A0A2E9ZQX4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=728 residues).
MEPTSRKENSSDKLHILDYWRIIRVRIVTILLVFLLTAITTTVVTFLIPKTYMSLSRIAVEKDTSDIAPLLGMQATQSSF
DPYFISTEFEKIQSQKVLDEVVRSCELREKWKKHYGGKQLTDVEARKHLEKVIDVSQYRNTSIIELRAYDRDKNLAQQIA
QALAKEYENYRSSLQEERVKAGIDKLRERMKKTNDEITAMQANVDDLRAKLGISDAAGEDSYSIVEPEIVRRYESELITA
KGLYTQQATLLQGLQEQGLEELRESIMTANPDAQLDALIREYQTGQTTLANKSIDLGEGHPTIKSLKAAMESLNQQIDNR
IKGILAGLELRVNSSLAQVRELQKSVDDAKAKEAKVQEEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDLDLPKTSSVE
IIDKADTPLRAVRPNVPLNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALDAAVLGVIPQNVGSLMDEGDESPHA
EAYRVLRTNILFAGRKSEDQTTFTVVSGGAGEGKTTTMFNLAVVFAQMGDRILVVDSDLRRPSMHRYFKVSNTIGLTNLL
LGQNTLDEVIQTSESPNLHFIPSGKLPSSSMGVLNSAKMKEFVAEMKSRYDYVFFDAPPIMGVSDASVLASAVDLCVLVV
QYRKYPQLMTQRAKDMVIKVGGXXVGVVLNNINISQDSYYYYYSGYYXDYYXKSRETEEEPVEDKKDGKEEKLIAQADAX
GXDVXPKX
>gnl|bykdb|A0A2G4G428 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=822 residues).
MSEENPNTGSTNSSSSSGSASGTNNTSRGSQRRGYGGGGYGGNYGGGYGGGYGGNYGGGYGGGYGGGYGGGNYGGGYGGG
YGRQRGGYGGGYGGGYGEGSSKDTEVSISTYVNMVRERIWWLVLSVLIFFTLSLVYTYNMMPEYKASGRLRVFRLAPNIS
GSNTAAESNFSITSADDFYTAVESMRSSTIIEAVSRQLTTAEKKEVLAPYQSGNIFSGPLSEQEVFSRQRSIMPQRQTLV
VNVEFTHPNRELARQVTTLFCKAIQKNSEDERLVITNPLVEKYRMDIDSVEDKIRKLYDKRNELIKGQKLLSIAKDTNTL
TAERAALVRAREDTRKAIDEMEIIWRLIGEYKQTGKDLYDVAQVRSDERVASFGSKISDLRVAVRTMEEKYTDEHPTLIQ
ARAQLKQTEAELQNAIVTSVNRIQVAIQNAHANYAAIISNLDKKDDEIARLTVANNELERVDKEIKSQEDFLSRQKQSFE
EAKIRSSTTGTTTSIKVLDSPSVADRPTNKNFYLNAIIGLAMGAIFGLGLIILLGTFDDRIKSPKEVEIALGIPILGTIP
QITKSVGPERALLAMHEKDVVAVEAVRTIYSSMRVNPASMSSHVFLITSTRPSEGKTFVATNLALGFSQHGERVLVIDAD
LRLPNVGPSLGLTGTEGISRWFNDESTIDESIVKNVAPNLDVLPVGMSCRNPTQVISSAKFIEMLTDMRSRYDRIFIDSP
PIGAVSDALNLIPNVDGVIYVVRYNFVSTRNVAECITRLREVGVPILGAVLNRMSMRMASVYTDSFDASYEKYYNAAAGA
AAKDDAGDAVASTENPEDNPKV
>gnl|bykdb|A0A2G4I5Y6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Pedosphaera sp] (length=730 residues).
MDAAPHQAEPAPATPENRLHFLDYWRIIRMRGLLIFVVFALVVGTTAVLTHSMEPTYMSTVRMDVQKDVGDITSLMPQQQ
QGGFDPYFVMTQFEILQSKEVLYKVIDELKLVQRWDQKYRLGQSKLKAYQVLTKLIDPRQVRNTSIIEINVYSKDKEEAA
EIANKIAEIYKENRESQRKLQAEKGIKILRARLLDQDALVRTALTNVNQIHQDKGLNVIHDGGGTIMSLETDTIRSLESQ
LTDIRGIYIKKQTSFVELKKLKPEQLKNALGPPVVNDEILSRRLEEYSAAEKEFVSKGKELGPNHPDYVRMQAVIVKLSQ
QVDDRVNGIMLSLETDLKAQAAALELTETKLEEAKVRNRTAAEKNRTYQMARDDLDDLKRLRATMNAKIIVEESDIDMSR
SNAVRVTDFAEAAIKAAYPKMPLNVALGAFVGLLLGIGLAFFIEYLDTSVKTIDDVERALQAPVLAVIPQNVGALLDEGM
DSPHAEAYRVLRTNVLFTRKDDAANAITVVSGGAGEGKSTTVLNLATIFAQNGDKVLLVDSDLRRPSLHKRLGLSNSLGL
TNYLLGQNTLEEVIQHSPLANLHFLPSGRLPSSALGILNSPQMKDFIKEAKRRYDFVFFDAPPIMGVSDATVLASGADLA
ILVIQYRKYPQSLAIRSRQMVEKVGGRLIGVVLNNINLASDASYYYYSGYNYRSNNNDDESSTNGKPPGKVDRHKPVAPV
ADATSIKPKY
>gnl|bykdb|A0A2N8HCB0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=778 residues).
MPVSVIQPEDNDIFSFRFIFSTARRYWPWILACALLGGGLAYFISARQGYLYQKTARIMLRDDKQKNAQVSEIILSDLGF
KPGEANLANESYVVKSSEVMGRVVKGLGLDVSYWEKRNIRKVDLYHTTPLKVEFSEEAAFQPCSLAVTPLNGREFSLSCR
EKEGGENVLHGKFGVPLKLPSATVKVCPTSYFSSGSMGRTIFVERVSVKEAAAGMLGRLSVTRPDSKESSLLELTLRLSH
PQKAEDALNYLIEVYNDHSRREKQLAASRAEEFIVKRIGKLGGQLGGVDKQVIDYKRNSRIVKDMDTTLDATFNRVQEIG
TELFSTRTELIQVKVLARLLADRSRQQDMIPANIGIQDAGIAKQIELFNDNFLQHKKLFASAGRQNPMVSSLAENMKEMR
ESIGRSIANYCNALEVRMSELEKERDELNRLLSDMASKDEGLVPLLREQKVMEELYLMLLKKREENALALATTEPSARIL
EPAFGSNAPVAPKLFLMTVGGMTGGALVSLLALLAGNALNTKVRDKKDLAGLTDLPLAGALPLLSGKERAKLPLVVMNGR
SLMEECFHILRNNAELMLLPNPEEASRVLFMTSTRAGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFYGGKNAR
GLVHLLMNPQVSPDSVLQSGRKFPGFDLVTAGPVPPNPVALLTQDRFEELLRYWRARYDRIILDGCPYEAVVDASLMARH
ADLVLYVIRCGMIEKQYVPAIQGLADKGEFRAVALILNAENFKNSRFHYYSEYSETDG
>gnl|bykdb|A0A2N8HD92 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=735 residues).
MNSQDQQNSDRIVRNIDYLQVLKNRWKEVFLVFLLVLVISVVVTFLMPPAYQTRCQFQIKLPKPVMEIGQGGDVVATSNV
TANYIPMQYSVLTSTEVLKIVSKKLNLAAEWGMTDEKAASNLAGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKTVPEAY
KQDREMRENRLVETAIKSLKDVLREQEDTVNEKMMALKKLIAESSYLPTTWRNGENRNTLTAGMEEEDFRNAKSQAMAFE
KDEKELASYVQELQRLPDDKLLDYVISSDLLNAESVGAKALRETYAEFSEKLKEKENLKAQNIGPKHPKMLALVETERIL
SDKLNKELIGLRSSLKSKLEMVSASRKHWEETVALKEKALQDHVLKVPMYEQASRDYDAALDQLKDLSSRYTDEIARLRV
PRDAVEMYDLPEYPAVAYKPSITINLAVGASVGLLLGIGLALFLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSD
VLGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNEVG
LTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGTLNSRKFSELLQEVKQRFDMVLVDSPPILGVSDSAVIVSEVDM
TLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSADGGSSGGNVDASSMKKAERSGKA
KELAANQSHDSEDLY
>gnl|bykdb|A0A2N8HDG3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=788 residues).
MPDTSAPPAVPPAEESESSLSLDVITGILLRRWYWILLFALIGGGAAYYLTGRQNYIFEKTASVIMRESSKESTSDRIKV
DLGMDSGAANLANESFILRSSTVMRSTVEDLALNISYWKQQDLRQIDLYRDSPITVTFDGIAENRFCNVDITLQEGNTLV
LTYHDINGNPVQEKGTFHSPIHLPFATVTVYPTSNMTETVPGTTITVRRTPVNAAADQLLANFTVMRPDAKESSILQMTL
TSTNPVKAADTLNKLIAVYNDHSTAERRTTAVKTKDFIREQRAQVGADLKQVDQKMDDIKIKNDIIADTEASISADFNAA
QTLDNSIFELQTQMKLADGLKESLNALGQKAGLISLDTGIADSGVSRQIEAYNTAYLEYQKVAGSAGGQNPIVVTLTKKM
DATRSAAARSLDNLRNNQKLQLQELTKKRENIGKRLTATSGKARELTPLDREHRVKEELYLTLLSKELENDLTLALTESS
ARVLEAAHGSDSPIAPNTRKSVLTAAAGGAIVCILGFLGLALLNNKVKNKKDLNAITSLPVVAELPAMTKKEQRQVARMF
TDEHSVISEYFQILCHNADSMLPVTRNQGHVILLTSTMQGEGKTFISANLALAFANIGKRVLVIDGDLRKASLSKQLDGK
GRKGLSTILLRKVEDPFSVIRTLPEHAGVDILYAGPHVPNPVTLLSLPELGTLIQMFKERYDAVIIDSPPYGILADTAIL
AGHADISLYVVRSNRIDKRHISTVQQLADSGQLPNLGFIINAVDFKAGSYSYYGYGYHYGNTSKNAHS
>gnl|bykdb|A0A2N8HID1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=793 residues).
MKDLSPKKESLDAGGAAPVSLLPSPRAIMGRIVRKWYWCVLSLCICLPLAYLYAARQPQVYGKATTILIKDDYPRESVAA
TVLASTNGIVNTGATNLDNEIFLLSSHSLLKTVVRNLKLDVTYWKKNGFRKVEIYQDSPIAAQFTQEGKTADARFLVIPV
SGTEFRLEKDEKDHHGHETGVFGKEIRFDSQAFIVEKTPKFDESSLNVPVIVRRTSVKNAAMGLGSGLTVRKASGKNDLI
NISMRCNNPVKAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDVISEEMKKNDLAIEDLKKETDVLTDLSTALTEE
YENSLNDKKDLRELELEIKSIEYLKDYLEQEAEHDARLVPINSKIADMGIRDQISVFNDTLLKRTSLKVNAGDNNPIIRE
LEANLNSLKDALKRSVNNYYTSLLVKKKNVQDQHEQTREHIRNVSSRERAVNHIEREQRVRESLYVLLLNKREENSLALA
ATEDNARMVDGVRGGNGPLEPNVPKILMVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETLTSIPVYGELPRKPRKLKNQ
EIVVNLEEPSELSECFPLLAERMVALSDGNEGNPLSVLITSTCSGEGKTYLSVNLALSLAVAGKKVLLMDMDLRKGALSA
LLGGAGKPGLGDLEQAGEGGWRSLVEQSPVSDHLDYLFAGTVPDHPSRLLLHDRIRKLMEEVKEQYDFIFMDCVPYSSLA
DARIVARLADVTLYVMRAGCVKKRDLAGLQKIWKNGELKRMGIVLCDVEPHGRSSRGYAVYRSLDTSSPCAGK
>gnl|bykdb|A0A2N8HIT2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=735 residues).
MNAQDQQNSDRIVRNIDYLQVLKNRWKEVFLVFLLVLVISVVVTFLMPPSYRATSQFQIKLPKPVMEIGQGGDVVASSNV
TANYIPMQYSVLTSTEVLKVVSRKLNLAAEWGMTDEMAASNLAGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKTVPEAY
KQDREMRENRLVETAIKSLKDVLREQEDTVNEKMMSLKKLIAESSYLPTTWRNGENRSTLTAGMEEEDFRNAKSQAMQFE
KDEKELASYVQELQRLPDDKLLDYVISSDLLNAESVGAKALRETYAEFSDKLKEKENLKAQNIGARHPKMLALLETERIL
GEKLNKELIGLRSSLKSKLEMVSASRKHWEATVAQKEEALQKHVLQVPMYEQASRDYDAALDQLKDLDSRYKDEIARLRV
PREAIEMYQLPTYPAAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSD
VMGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNEVG
LTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDM
TLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSADGGSSGENADASSMKKAERSGKA
KELAATQSHDSEDLY
>gnl|bykdb|A0A2N8HNL6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=789 residues).
MPDTPAPPAAPPAEEPESSLSLDVITSILLRRWYWILLFALLGGAGAYYVTGKQNYIFEKTASVIMRESNKDSSSSDRIK
VELGMDSGAANLANESFILRSSTVMRNTVEDLTLNVSYWKQQDLRQIDLYKDSPITVTFDDIAENRFCTFDVTLEPENAV
TLTYHDAAGNPIQEKGKLHAPISLPFATVTVYPTSNMPETVSGTTITVRRIPVNAAADQLLANFTVTRPDAKESSILQMT
LTSTNPDKAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQIGADLKEVDQKMDDIKIKNDIIADTEASISADFNA
AQTLDNSIFELQTQMKLADGLKENLDALGHKAGLISLDTGIADSGVSRQIEAYNAAYLEYQKVAGSAGGQNPIVVTLTKR
MDATRSAASRSLDNLRNNLELKLQELTRKRQDIAKRLTATSGKARELTPLDREHRVKEELYLTLLSKELENDLTLALTES
SARVLESAHGTDYPISPNTRKSVLTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAVTHLPVVAELPAMTKKEQRQVARM
FTDEHSVISEYFQILCHNADSMLPVTRNQGHVILLTSTMQGEGKTFISANLAISFANIGKRVLVIDGDLRKASLSKQLDG
KGRKGLSTILLRKVEDPFSVIRTLPEHPGVDILYAGPQVPNPVTLLSLPEMEELIRLFKERYDAVIIDSPPYGILADTAI
LASHADISLYVIRSNRIDKRHIATVQQLAESGQLPNMGFVINAVDFKSSSYSYYGYGYHYGNTSKNNPS
>gnl|bykdb|A0A2N8HP04 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=778 residues).
MPVSVIQPEDNDIFSFRFIFSTARRYWPWILACALLGGGLAYFICARQGYLYQKTARIMLRDDKQKNAQVSEIILSDLGF
KPGEANLANESYVVKSSEVMGRVVKGLGLDVSYWEKRNIREVDLYHTTPLKAEFSEEVAFQPCSLAVTPLNGREFSLSYR
AKESGENVLHGKFGVPLKLPFATVNVCPTSYFSSGSMGRTIFVERVSVKEATDGMLGRLSVTRPDSKESSLLELTLRLSH
PQKAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRIGKLGGQLGGVDKQVIDYKRNSRIVKDMDTTLDATFNRVQEIG
TELFSTRTELIQVKVLARLLADRSRQQDMIPANIGIQDAGIAKQIELFNDNFLQHKKLFASAGRQNPMVSSLAENMKEMR
ESIGRSIANYCNALEVRMGELEKERNELNRLLSDMASKDEGLVPLLREQKVMEELYLMLLKKREENALALATTEPSARIL
EPAFGSNAPVAPRLPLMTMGGMAGGAFASLLALLAGNALNTKVRDKKDLAGLTDLPLAGELPLLSGKERKKLPMVVTNGR
SFMEECFHILRNNAELMLLPNPEEAPRILFLTSTRAGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFYGGKNAR
GLVHLLMNPQVSPDSVLQSGKRFPGFDLVTAGPVPPNPVALLTQGRLEELLRYWRARYDRIILDGCPYEAVADASLMARH
ADLVLYVIRCGMIEKQYVPVIQGLADKGEFRSGAVILNAENFKNSRFHYYDEYSETDG
>gnl|bykdb|A0A2N8HRJ0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=778 residues).
MPVSVIQPEDNDIFSFRFIFSTARRYWPWILACALLGGGLAYFICARQGYLYQKTARIMLRDDKQKNAQVSEIILSDLGF
KPGEANLANESYVVKSSEVMSRVVKGLGLDVSYWEKRNIREVDLYHTTPLKAEFSEQVAFQPCSLAVTPLNGREFSLSYR
AKESGENVLHGKFGVPLKLPFATVNVCPTSYFSSGSMGRTIFVERVSVKEATDGMLGQLSVTRPDSKESSLLELTLRLSH
PQKAEDALNYLIEVYNDHSRREKQMAASRAEEFIVKRIGKLGGQLGGVDKQVIDYKRNSRIVKDMDTTLDATFNRVQEIG
TELFSTRTELIQVKVLARLLADRSRQQDMIPANIGIQDAGIAKQIELFNDNFLQHKKLFASAGRQNPMVSSLAENMKEMR
ESIGRSIANYCNALEVRMGELEKERNELNRLLSDMASKDEGLVPLLREQKVMEELYLMLLKKREENALALATTEPSARIL
EPAFGSNAPVAPRLPLMTMGGMAGGAFASLLALLAGNALNTKVRDKKDLAGLTDLPLAGELPLLSGKERKKLSLVVTNGR
SFMEECFHILRNNAELMLLPNPEEAPRILFLTSTRAGEGKTFTALNLAAAYAQTGKKVLLIDGDLRKASLSAFYGGKNAR
GLVHLLMNPQVSPDSVLQSGKRFPGFDLVTAGPVPPNPVALLTQGRLEELLRYWRARYDRIILDGCPYEAVADASLMARH
ADLVLYVIRCGMIEKQYVPVIQGLADKGEFRSGAVILNAENFKNSRFHYYDEYSETDG
>gnl|bykdb|A0A2N8HS06 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=793 residues).
MKDLSPKKESLDAGGAAPASLLPSPRAIMGRIVRKWYWCVLSLCICLPLAYLYAARQPQVYGKATTILIKDDYPRESVAA
TVLASTNGIVNTGATNLDNEIFLLSSHSLLKTVVRNLKLDVTYWKKNGFRKVEIYQDSPIAVQFTQEGKTADARFLVIPV
SGTEFRLEKDEKDHHGHETGVFGKEIRFDSQAFIVEKTPKFDESSLNVPVIVRRTSVKNAAMGLGSGLTVRKASGKNDLI
NISMRCNNPVKAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDVISEEMKKNDLAIEDLKKETDVLTDLSTALTEE
YENSLNDKKDLRELELEIKSIEYLKDYLEQEAEHDARLVPINSKIADMGIRDQISVFNDTLLKRTSLKVNAGDNNPIIRE
LEANLNSLKDALKRSVNNYYTSLLVKKKNVQDQHEQTREHIRNVSSRERAVNHIEREQRVRESLYVLLLNKREENSLALA
ATEDNARMVDGVRGGNGPLEPNVPKILMVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETLTSIPVYGELPRKPRKLKNQ
EIVVNLEEPSELSECFPLLAERMVALSDGNGGNPLSVLITSTCSGEGKTYLSVNLALSLAVAGKKVLLMDMDLRKGALSA
LLGGAGKPGLGDLEQAGEGGWRSLVEQSPVSDHLDYLFAGTVPDHPSRLLLHDRIRKLMEEVKEQYDFIFMDCVPYSSLA
DARIVARLADVTLYVMRAGCVKKRDLAGLQKIWKNGELKRMGIVLCDVEPHGRSSRGYAVYRSLDTSSPCAGK
>gnl|bykdb|A0A2N8HT11 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=789 residues).
MPDTPAPPAAPPAEEPESSLSLDVITSILLRRWYWILLFALLGGAGAYYVTGKQNYIFEKTASVIMRESNKDSSSSDRIK
VELGMDSGAANLANESFILRSSTVMRNTVEDLTLNVSYWKQQDLRQIDLYKDSPITVTFDDIAENRFCTFDVTLEPENAV
TLTYHDAAGNPIQEKGKLHAPISLPFATVTVYPTSNMPETVSGTTITVRRIPVNAAADQLLANFTVTRPDAKESSILQMT
LTSTNPDKAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQIGADLKEVDQKMDDIKIKNDIIADTEASISADFNA
AQTLDNSIFELQTQMKLADGLKENLDALGHKAGLISLDTGIADSGVSRQIEAYNAAYLEYQKVAGSAGGQNPIVVTLTKR
MDATRSAASRSLDNLRNNLELKLQELTRKRQDIAKRLTATSGKARELTPLDREHRVKEELYLTLLSKELENDLTLALTES
SARVLESAHGTDYPISPNTRKSVLTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAVTHLPVVAELPAMTKKEQRQVARM
FTDEHSVISEYFQILCHNADSMLPVTRNQGHVILLTSTMQGEGKTFISANLAMSFANIGKRVLVIDGDLRKASLSKQLDG
KGRKGLSTILLRKVEDPFSVIRTLPEHPGVDILYAGPQVPNPVTLLSLPEMEELIRLFKERYDAVIIDSPPYGILADTAI
LASHADISLYVIRSNRIDKRHIATVQQLAESGQLPNMGFVINAVDFKSSSYSYYGYGYHYGNTSKNNPS
>gnl|bykdb|A0A2N8HZF2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=798 residues).
MTNNTAPTPPVTENTEETALSLDTVLTILRRYWFIIILAALAGGTAAYYLAGRQNYIYQKTASVLMRDAKTSSDASSERI
MAELGIDSGAANLANESFILKSTALMKKVVEDLNLNTSYWQKKDFREIDLYKTSPLLVHFERIDKQRACTLQITPLDEKR
FMLSHSNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMTDAWNGKTVIVRHSPVLETANALLRGLTITRPDSKESSLLEM
TLTSSNPQKAEDTLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEFKTKSDIVKDTDTTMSADFS
TSQALEKEIFDLETQIKLAAILADNLKETERKQGLISVETGLPDSGIARQIEHYNEAYLEYQKIAGSAGSQNPIAVSLRE
RMNSTRAAANKALSNYRSNLNLKLNQLISKRNSLTERLTETAIREQEIIPLVREHKVKEELYLMLLSKEQENALAMAVTE
SSARVLETAHGPNIPISPKTIKYVAGGTAGGVLLSILAFMGAAMLNNKVNNKHDLPAANRQPVIAELPQMNKKESRNTGL
FIQDEHSVIAECFHILRNNVDSMLPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLG
GSGRKGFTSILLQQNPDTTGIIRPLGGNSRGMDILYTGPMVPNPVILLSHPLLGHILGILKKQYDAVIIDAPPYGILADT
AILASLSDITLYTVRSGKIDKRYLLQIQQLADQGKLPNMAYIINGVNFKSASYSYYGYGYQYGYGTKKPQQTSRKQNK
>gnl|bykdb|A0A2N8I3A6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=735 residues).
MNAQDQQNSDRIVRNIDYLQVLKNRWKEVFLVFLLVLVISVVVTFLMPPSYRATSQFQIKLPKPVMDIGRGGDVVATSNV
TANYIPMQYSVLTSAEVLKVVSRKLNLAAEWGMTDEMAATNLADMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAY
KQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTSWRNGEHRSTLTAGMEEEEFRNAKAQAMDFE
RREKELASYVQELQRLPDDKLLDYVISSDLLNAETVGADALRKTYAEFSDKLKEKENLKSQNIGARHPKMLALLETERIL
GDKLNKELIGLRSSLKSKLEMVAASRKHWEATVAQKEEDLQKHVLQVPMYEQASRDYDAALDQLKELDSRYKDEIARLRV
PREAIEMYQLPTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSD
AMGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNEVG
LTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDM
TLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSADGSSSGENADASSMKKVERSGKA
KELAATQSHDSEDLY
>gnl|bykdb|A0A2N8I441 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=735 residues).
MSAQDQQNSDRIVRNIDYLQVLKNRWKEVFLVFLLVLVISVVVTFLMPPSYRATSQFQIKLPKPVMDIGRGGDVVATSNV
TANYIPMQYSVLTSAEVLKVVSRKLNLAAEWGMTDEMAATNLADMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAY
KQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTSWRNGEHRSTLTAGMEEEEFRNAKAQAMDFE
RREKELASYVQELQRLPDDKLLDYVISSDLLNAETVGADALRKTYAEFSDKLKEKENLKSQNIGARHPKMLALLETERIL
GDKLNKELIGLRSSLKSKLEMVAASRKHWEATVAQKEEDLQKHVLQVPMYEQASRDYDAALDQLKELDSRYKDEIARLRV
PREVIEMYQLPTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSD
AMGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKSTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNEVG
LTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDM
TLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSADGSSSGENADASSMKKVERSGKA
KELAATQSHDSEDLY
>gnl|bykdb|A0A2N8I9W1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=798 residues).
MANNTAPTPPVTENTEETTSLDTVLLVLRRYWFIIILAALAGGTAAYYLAGRQNYIYQKTASVLMRDAKTSSDASSERIM
AELGIDSGAANLANESFILKSTALMKKVVEDLNLNTSYWQKKDFREIDLYKTSPLLVHFERIDKQRACTLHITPLDEKRF
MLSHYNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESSLLEMS
LTASNPQKAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEFKTKSDIVKDTDTTMSADFST
SQALEKEIFDLETQIKLAAILADNLKETERKQGLISVETGLPDSGIARQIEHYNEAYLEYQKIAGSAGSQNPITVSLRDR
MNSTRAAANKALSNYRSNLNLKLNQLISKRDSLTERLTETASREQEIIPLIREHKVKEELYLMLLSKEQENALAMAVTES
SARVLETAHGPNFPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESRNTGLF
IQDEHSVIAECFHILRNNVDSMLPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLGG
SGRKGLTSILLQQSSDTTGIIRPLRENSRGMDILYTGPMVPNPVTLLSHPLLGQILGILKKQYDAVIIDAPPYGILADTA
ILASLSDITLYAVRSGKIDKRYLLQIQQLADQGKLPNMAYIINGVNFKSSSYSYYGYGYGYQYGYGSGEPRQTTRKQD
>gnl|bykdb|A0A2N8IBZ6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=798 residues).
MANNTAPTPPVTENTEETTSLDTVLLVLRRYWFIIILAALAGGTAAYYLAGRQNYIYQKTASVLMRDAKTSSDASSERIM
AELGIDSGAANLANESFILKSTALMKKVVEDLNLNTSYWQKKDFREIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRF
MLSHSNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESSLLEMS
LTASNPQKAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEFKTKSDIVKDTDTTMSADFST
SQALEKEIFDLETQIKLAAILADNLKETERKQGLISVETGLPDSGIARQIEHYNEAYLEYQKIAGSAGSQNPITVSLRDR
MNSTRAAANKALSNYRSNLNLKLNQLISKRDSLTERLTETASREQEIIPLVREHKVKEELYLMLLSKEQENALAMAVTES
SARVLETAHGPNFPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESRNTGLF
IQDEHSVIAECFHILRNNVDSMLPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLGG
SGRKGLTSILLQQSSDTTGIIRPLRENSRGMDILYTGPMVPNPVTLLSHPLLGQILGILKKQYDAVIIDAPPYGILADTA
ILASLSDITLYAVRSGKIDKRYLLQIQQLADQGKLPNMAYIINGVNFKSSSYSYYGYGYGYQYGYGSGEPRQTTRKQD
>gnl|bykdb|A0A2N8IJW9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=798 residues).
MANNTAPTPPVTENTEETTSLDTVLLVLRRYWFIIILAALAGGTAAYYLAGRQNYIYQKTASVLMRDAKTSSDASSERIM
AELGIDSGAANLANESFILKSTALMKKVVEDLNLNTSYWQKKDFREIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRF
MLSHSNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESSLLEMS
LTASNPQKAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEFKTKSDIVKDTDTTMSADFST
SQALEKEIFDLETQIKLAAILADNLKETERKQGLISVETGLPDSGIARQIEHYNEAYLEYQKIAGSAGSQNPITVSLRDR
MNSTRAAANKALSHYRSNLNLKLNQLISKRDSLTERLTETASREQEIIPLVREHKVKEELYLMLLSKEQENALAMAVTES
SARVLETAHGPNFPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESRNTGLF
IQDEHSVIAECFHILRNNVDSMLPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLGG
SGRKGLTSILLQQSSDTTGIIRPLRENSRGMDILYTGPMVPNPVTLLSHPLLGQILGILKKQYDAVIIDAPPYGILADTA
ILASLSDITLYAVRSGKIDKRYLLQIQQLADQGKLPNMAYIINGVNFKSSSYSYYGYGYGYQYGYGSGEPRQTTRKQD
>gnl|bykdb|A0A2N8IMT3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=735 residues).
MSAQDQQNSDRIVRNIDYLQVLKNRWKEVFLVFLLVLVISVVVTFLMPPSYRATSQFQIKLPKPVMDIGRGGDVIATSNV
TANYIPMQYSVLTSAEVLKVVSRKLNLAAEWGMTDEMAATNLFGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAY
KQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTSWRNGEHRSTLTAGMEEEEFRNAKAQAMDFE
RREKELASYVQELQRLPDDKLLDYVISSDLLNAETVGADALRKTYAEFSDKLKEKENLKSQNIGARHPKMLALLETERIL
GDKLNKELIGLRSSLKSKLEMVAASRKHWEATVAQKEEDLQKHVLQVPMYEQASRDYDAALDQLKELDSRYKDEIARLRV
PREAIEMYQLPTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSD
AMGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNEVG
LTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDM
TLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSADGSSSGENADASSMKKVERSGKA
KELAATQSHDSEDLY
>gnl|bykdb|A0A2N8IWC2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=735 residues).
MSAQDQQNSDRIVRNIDYLQVLKNRWKEVFLVFLLVLVISVVVTFLMPPSYRATSQFQIKLPKPVMDIGRGGDVVATSNV
TANYIPMQYSVLTSAEVLKVVSRKLNLAAEWGMTDEMAATNLADMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAY
KQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTSWRNGEHRSTLTAGMEEEEFRNAKAQAMDFE
RREKELASYVQELQRLPDDKLLDYVISSDLLNAETVGADALRKTYAEFSDKLKEKENLKSQNIGARHPKMLALLETERIL
GDKLNKELIGLRSSLKSKLEMVAASRKHWEATVAQKEEDLQKHVLQVPMYEQASRDYDAALDQLKELDSRYKDEIARLRV
PREVIEMYQLPTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSD
AMGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNEVG
LTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDM
TLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSADGSSSGENADASSMKKVERSGKA
KELAATQSHDSEDLY
>gnl|bykdb|A0A2N9NTX7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=723 residues).
MDPIPVPPPQESKLHFLDYWRIIRIRKTVILAVFLLVVITATVVTFILPPKYKSMARIKIERDQTDIPSLTQQQGSFSPY
DPYFMQTEFELMKSEVVLDKVIKNLNLNEEWGKLEGGAPLKKQQTIDKLKRMMDPRQVRNTSLVEIWVTSFNKEEAAKLA
NEIAEAYQAHRLEERAELTTGGIKSLEERWKEQEASVGKAQSNVDYLRDKLKISDPNSGAEMPGPLLTTESLHRIEGLRI
ESSAELVKMETLLSKLEELQRTNPAALIQTIPITAPDSYLNSLMEQVTVADQRLVMVQKDYGPENDETKKARESVSDLKQ
KIKDRVDGIMLGLQAKVASVRESLDQMKKEVDEATKTDISKASESAPYWKAKRELEEQEHFRAILDLKIISEKVDLSLPK
TTMVEIVDRAVAPLFASSPNKTLNIALGVIVGLVVGIGLAFFIEYLDTSVKTIDDVERSLQSPVLGVIPQNVGLLVDEGV
ESPHAEAYRVLRTNLLFSRKDEKLNTVAVVSAGAGEGKSTTVFNLACVFAQGSQRVLIVDSDLRRPTLHRMLRVSNSIGL
TNYLLKQNTLEEVIQTTNLPSMDFLASGKLPSSSLGILSSSQMRDLINELKQRYDFVFFDSPPIMGVSDASILASEVDMT
LQVIQYRRYPQPMNIRAKQLIEKVGGNLIGIVLNNINMSQDESYYYYSGYYHDYYSRNEDQEKGSGPDEGPGDKTKLDIK
PKY
>gnl|bykdb|A0A2S7U4L6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Rubritalea profundi] (length=714 residues).
MQPNNSLNTSDATLHAVDYLQILKNRYGIILLTFILVVLTAAVITYVMPKKYEAIAVVKINPLGTNNQVLGSGSSALMTR
QFFGTEFKKIESDENLKRAAELVQLPQKMQISTDEAILVLKGGLSARQERGTDLIEISLRMVKDNRQYVKPATEAIALAY
SEMRINQETKRRDKTRVELAKKIQKYEDIVEDYRTRLLEFSAKTGIYSLDRSSGGATDVVRRDLQQENMLYDEAVKARDE
LERQVKDLVGLDDETLISHVSGLNRPESAVLALTFQQYQDAKRERAGVIAQGLGENHPQVKHHDSQISILRETLDAKVRR
VRDLLKVLLEQAGAKIARLQISKDASQSDAKNTAEDYTRFQSYQDEYKDSVNNLNTLRTSNVIEELQENMSIEPIEFYSY
PQEPEVADYVSPNWILNMALGSVAGMIFGIGIAFSLELMDTSVKSLEDVERYLQVPVLAVVPRDVGVLYKMSTASPDAEA
YRILRTNIEFNRPSQDDNAITVVSGGAGEGKSTTLVNLAYICAQGGYSTLMIDADLRRPRLHTFFDINNSVGLTNYLTTT
LPLEDVVLQTSIENLYFMPSGILPADASGILNSRRMSELIQEVKSRFDLVLVDSPPILGVSDASVISSEVDLTMIVVQHR
KLPRNMLVRVKQAVENVGGTVLGVVLNNVDLRSDSQYQYYTSYYTYYAPGQNKSAAAEATAKSSSDSPKTNDLY
>gnl|bykdb|A0A2T6CN73 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutus sp. ER46] (length=742 residues).
MAAEQEKHAPGESGGGYSYGTGGNYAGYSAAGYGYGDAGESSTIQRTFQDYLLIVRERIWYIVVVFLVVFSSALVYTLSK
PKIYESTATVQIFRRDPTIMPGQQVVDTDIRSTEDLNTQVKVIESEAIIESVASRITGQELREFLAPYDTGAPEKPSVAR
LLKLNRRVIPQRLTLMVWIAYKHPNRFVAAKVANHFARAYIDYNTQLRISEGVKAVEDLKGPVETQRKLVERLASELQRY
KEQHKMVSLDQRKDIVSESLKAINLEVARASIALNAAENRRNQVAELKARGGNLTELPFIATQATIVELLKQLAAQKVQL
EQLGARYRAKFPKMIEAQNSYDQIKRELDRAIASACAQVESDYQSALNTYRQNQEELKRRTQDSLAVDHAALDYENMQRE
LKIQEDILTTITARRTETSMSSNIATQNARIIDLAQESPEGRPISPNVPLNLGLGVIGGLGLGLAFAFFVAFIDDRVKSS
FDIEGVVGLPLIGIIPEIKKLEQVEKAQIVATNTDRLASEAFLTLHSSLRLKDESKNAKCILTTSTIPGEGKSLTTTNLA
LTFAAHGEKVIVVDCDLRKPNIHKSFRIENIRGVIDVCSGKATLDEVIVRNQQPNLDVLPTGGRAKNPTHILNSKAFETM
IADLRKRYDRVFIDTPPLAAVSDALIILPLVDGSIFTIFFNKVRRKAAQFAAKRLLDSNVPNFGAVLNGLNLVVSGYYYA
QYYDKSYKDYYVVSKGDTEQER
>gnl|bykdb|A0A2T6CWI7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutus sp. ER46] (length=720 residues).
MADANAKPPPPPPVDHDDETVSERRTLRDYYIMLRERLWIALPLALLVAVGYAYKNLQETPRYAATARMQFEKPDRIVMA
EGVVDTAVRSEVDMNTHTEVLKSSSLREEVVASFSADEIKVLQRAALKRLPPGSPPTNVGIPMGELSVFPIRNTYLIAVT
VTHDDPDAAALVANRFVEVFMKRLYDTAGGRTADAVKFLREQASRLEREAQEKEQALQQYMTKHQLTSLDTSQSMSDEAL
KKAHTMRDDARLRLMAVDEKITQVEAYQKEKRNLFEVVEIANYGAVPSLRAQLSTLQQEQNILSERYYERHPRMIDVANR
IDVTEKELAKAVQLAIDDLRARQAEARQAYESFSAEFAQREKDAMRLGELRVEFNSLVQQSQVARENYQNIFKRLTDTTT
VKNLDKIPLHPLDHAVANRWPVSPNRQKITRTAIGLGLMVFLGVALGLSFIDDRIKSAWDVESFVGANLLGIVPDLGNLK
DEEKYTLMLTEKQVQGAESFLSVYSSIKIHSKLDFPKSVLVTSTIPGEGKTLISCNVAGCFARHGKKTLLIDCDLRRPML
HRHFKQENKNGLITWFESGAMLDSNLTTHPSLGIVPVAENLWLLCSGGRSKSPTELLENPVFGQLLERLKKEFDLVIVDS
PPLGAVTDSVLIAERVDEIVYVCRFNRAYRKHIRLYMRTLRQGKNEVLGIVLNGLSPRRIEYYSNYRYYRSYKKYYGAQT
>gnl|bykdb|A0A2T6D3Y2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Spartobacteria bacterium LR76] (length=718 residues).
MSFESPDSGEIKLHFLDYWRVIRVRLPLIILVLLLVVITAGVVTYFMPKQYASTVTMQIRQNDKVLQVFGQGGVQGLDPR
FLATQFEIIQRKEILYPVIDALGLDRKWGMPSREQAYFRLVRMINIQEIRNTELIHITVYSTDNKEAMEIANRIAEEYQK
RRLSEENEFLGKSLAQLQQEVEKQQAVVTKLQDTMTKIRQETGIQDLNPDTADGGTQSENSILLQVEQQVSQESLRVAAL
RAKYDQVSKMTDEQIMRSLTTLEIEDPTITQLYPQFQEAASEEARMLNAGLGVNHPNVKSLRAKKEVMQRQLAEQTAILR
KTLETNLTIAEQGLTSLQEKLTKVRADWQTSKTSSIGYYEAKNNWLQARKVLEAAQTRLATEKMEQTIPQSPTTIWETAE
ISLVPAKPNVVLNMVLGVIVGLVFGVGLAFFIEYLDTSVKTMEDVESFLKVPVLAVIPKGISLLVNETKENADAEAYRIL
RTNIEFNRKNPDANTITMISGGAGEGKSTTMSNLASIFASGGYSTLIVDADLRRPSQHRIFGVENEVGLTDFLTTDVHLE
EVVNQTKIDNLFLMTSGRLPADAVGILNSQRMVDLIEEVKHRFDIVFFDSPPILGVSDASVLSSAVDLTIIVVQHRRFPR
AMLQRVKQAVHNVGGNILGVVLNNVDVRHDQHYQYYTSYYNYYYQKPQQQKADKKPAKKAPVSAVQQLNGEKDQEDTY
>gnl|bykdb|A0A2T6D6H8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Spartobacteria bacterium LR76] (length=765 residues).
MVNKGAENKDRKSAAQVTLLRELSGEVIDFERLLNLLRARAWLVIVVAVIFFAAAFAYALRSPKIYESRALIQVEQASQN
VVDIDDIARENPQTTDFVNTVVQALTSRKLMLRVVKATGLDHNPEFAPPRSNGGKYTDIELADRLASKVSAKLRRGTRLI
ELTVEDKNPELAQKIAFSIVREFLRENFDQKLALSRVANEFLQEESEKLKAKLETSERKLQAYREQNKAVSLEERQNIIV
EKLRELNTKVTEAKSKRLQLEADIEQLKRVEKANVDELLSINSVSQLPHVAVIREQLVSAEAELAALKDRYLPKHPKYIA
GVTRIANLKQALDSEVKQAGETLSRLYEASRESEMKLETALQEQEERALELDKVAIPYNVLQRDVESDRALYESVTKRLK
ETAITQGVEQPPFRIIEEPMVPSAPAKPRVKVILAAGLLLGVMAGVGLVFVLDLLDHSLRTVDEAESFLDLPALAAIPEK
RIETVLNQVGEAIREKKLSKIPQEIAGKGVVEPVRKFLNAREATAQAKRHPLVFIDDPASLQAEAIRTLRTSLSLLGKQE
TRRTFLFASSIPEEGKTFTSLNFAHSLAQQGLRTVIIDADLRKPRLKADLLPEEGDISGLTNYLSGTATLTEVVKKTPYE
NLFLLPGGHRAPNPAELLNEDDFQKMLDELLKSYDRIVVDTAPVNAVSDVLLIANCIQTTCLVVHAGRTPKKAVLRAVRQ
LQKTGARLGGFVFNRLPVGGQSAGYYYYYYGGDYAKNGVYGAKAG
>gnl|bykdb|A0A2T6DFL8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutus sp. ER46] (length=716 residues).
MANVHAAPVGASVAGFLQILRQRQWLIALILALVVVTTIGVTAFLPKGYRATTKVRVERPDGQVKLFQAQTSPSYDPVFL
QDQFKIMQSEKILYPVIERLDLNRKIAALKDSPAAFPSAVTYAILTRKMLRVESQRASSVIEINVDAEDPQLAADIANEV
ARTYSADRIALATSDQSEGMAQLRQELLKQEQAVTRQRDAVEKLRKELNISGVDLNARYSDMEIETLRQMQNTLIALSVD
AIGRKTRWERFKSIPAGERQSLVNSELIPDQNIQNLLQAYLVADQKVTQLQGRLGEAHPDLIAAVDNRAKIKEQLDAQLR
GYENSLEIAYKEAEARVAELKSQLAQAKVDQILSARDRMRPFEEAAQKLEDETRLLTTLKLTLRQREIDFQVPKKTIEIL
NTAEAPRFPIRPSWPLNLTFAFVFGAVLAVGVAVVLEYFDTSFRNVADVEARLGLPVLGVIPFAQDPLARGGDDPAELEP
YRVLYTNLNLALKPGQAHALVFSSAGPGEGKSTTLHRLTRLMGEMGDRVLLIDADLRRPTQHRIAERPRSPGLSDLLTAQ
KTLDEVIQKSISPGLDFIASGAAGNFTLSLIYANRLRELMTTLRGRYDRIVFDSPPIIGVSDTSVLMTVVDGVVLLIQHR
RNPQSMVLRAQQIVGGVKASILGIVLNQIPGNAGGDYGYYTSNYAYYHEGSRRTRRSARSDKKPEAGGEDRLDLHE
>gnl|bykdb|A0A2T6DT99 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium EW11] (length=729 residues).
MASTHASREGASLADFFQLLRLRKALIFLILSLVVVTTAVVTALMPKWYVSTLNVRVEKPEGEVKLFQNQQSAYYDPYFL
QDQFKIMQSAKILYPVIERLQLNEKLAASQGSSVPLPTDVTYLLLVNKMIRIETPRGSSLIEIEVSAQDPALAAAIANEI
GTAYSADRIDFATSQQREGLAQLRKELEKQEKVVTSQRDLVEKLRKDLNISGVDLSARYSDMEVETLRQMQNSLIALSVD
AIGRKTRYERFKSIPPEERLNLVNSELIQDPNIQNLLQAYLVADQNVAKLKTRLGEAHPELIAAMENRAKIREQLDGQLR
GYENALEIAYKEADARVAELKNQLGQAKVDQILSARERMRPFEEALQKLEDDTRLLSTTKLTLRQREIDFQVPKRTIEIL
NVAEPARRASRPNWSLNLVFAVLFGTILGVGTAVLVEYFDTSFRNVAEVEARLQRPVLGVIPNAPDPLKKDAAGEDPAEL
EPFRVLHTNLNLALKSDARGRTLILLSAGPGEGKSTTLLRLARAMAKAGERVLLIDSDLRRPTQHQLAGLRKEPGLAEVL
QGKATLQSVTQREIQPNFDFIPCGSVGSFSLTLLYVDRLKALIQELRGQYDRIVFDAPPIIGVSDASVLASVMDDVLLLV
QHRRNPQSMVMRAQQIIEGLGKTIVGIVLNRVPRNSGEDYGYYTHNYAYYSSHGRRRSRRSRRDDADGESDSRGDRIEYV
ERERRRSKE
>gnl|bykdb|A0A2U8DZK4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Ereboglobus luteus] (length=716 residues).
MAYSDPVKESAPLPAFLQTLNLRKALILLILALVVITTIAVTAFLPKWYRSKASIRVLKIGTTSAVFQAQSNDYYDPYFV
QDQLRTIKSPKIINPVIERLKLNEKLAAVLEIPGPLPVDFTYDYLIKKRIVSVESPKTSSIVEITIDTRDPALSAAIANE
IVGVYTEDRINLATAAQKADLAELNNQLAAQEKIVIAQRDTVERLRAELSISGIDLTNPRNNSMEIERLRQMQSTLVALT
VDANSLKTRYESFRDIPPDKRLSLVNAQLIEDPGTQRLQQIYLEAEQNVTKLSARLGEAHPEMIVARENLSKIKTQLEAQ
LTGYEFTLKSKAEEAEARVTELKKQLEEAKASQIENASKRMRPFEEAMQKLDEATRLYTTFKLTLRQREIDYNQPKRPVE
ILSKAEPKLEPERPSWPINITFAILFGVVLGIGTALLIDMFDASFRSVADVERRLQRPVLGVIPSSLTARKPAEEPLDPA
EDEPFRVLQTNITLALRNKPSHGAQTLVMLSAGPGEGKSTTLLRLARAMGAAGERVLLIDADLRRPTQHRLFNVAKTPGL
ADLLQSKVTLDQCRSRNIAPGLDFIPSGTISGFTLSLFYADRLKEILADLRTQYDRIVFDAPPIIGVSDSAVITSLIDHV
LLLIQYRRNPLSMVLRAQQTILGLDKEILGVVLNRVPKNAGADYAYYSKNYAYYGSKSARTRDKTAGDTINFSEKK
>gnl|bykdb|A0A2V2BXR0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=715 residues).
MMILRERWAYILITALIILAGVILYTLRVTPIYMSVSRVQILRDSDVAIEGPGSTDRSRNNTVLTIEDFNTQVKILESNE
IIKAVKSRMKEDEIVRFMAPFNDMLTLGPRKTEEELLAENRTIAPERMSLIIRIAFEHPDPDMAATIANLFAQEYLNYTH
HTRVQKILDSIDELRIKVSQQEAKVKELDKRLVEYREQYKAISLENLDDVDRNELRDINTILTSDKRAYDAASTQWNLVQ
EFKRDGKDLADLPFIAELPQISKLLTDKSSQQVFVASAEKRYKEKHPRMIEARKALDQINKELASAIESAEQKVQAAYEA
ARQNYEQSQKRLLEKKEQILDLGRKAIVYKSIEREKQVAEGMHAAFIASMNVRLAQVNLINEGANIIDKASPGIRPVRPN
IPMNITLGILGALAGGVMVAFIVAFMDDRAKSAYDIESVVGLPLLGVIPRIRRLNSSQKAQVAVSNADRATTEAFRSVHS
MLKVNNIAKDSKVLLFTSTTPSEGKSFVVTNLALMCAMHGEKTIIIDADLRLPAMAKVLGIESRDGIVGYVEDGRPLEDC
VIKDYYPNLDVLPCEKRSQNPTQALSSEEFISMIAKFREQYDKVFIDSPPVGAVSDAIALLPYVDGVIYIVKFNSVSRKA
IQKNVRRLMVSNVPVVGAIMNMVSQGSAAGYSLNYYDKSYQNYYTMPDVEEEDSEGEEAQKGGESEDPENSENSK
>gnl|bykdb|A0A2V2DJ66 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=802 residues).
MENSDSKTPAQDGASQNAPSSQGAKSVRKKRNSGYGYGYNYSAYGNYGGYGGYYGGYGAYGGYGGYGYGTNPAASGEGAE
APNRTLRDYFMILRERLWYIIVTFIVIFSGIALYTLRITPLYTSASSVLIFREAAAPIDGPGSSDRTRNDKVLSVEDFNT
QVKILESNEVIRAVRSRLKEDDLRKLMAPYKDMFTFGPRKTEEEILQMNRRVIPERMSLMIRVTYTHPNAEMAARIADLF
VNEYITYTRMTRVQTLLDSIEELRTKVAQQETKVKELDRRLVEYREKNGAISLDQMDDVDRRELQEMNTILTTDKRTYDA
AAIQWSLLQEYKRDGRDLCTLPFIADLPIISKLVSDRSQYQVSVSTLEKRYKEKHPRMIEARKALDQVDKELAAALDSAY
EKVRSTYLTMKNNYEMSQQRLNKKREEILQLGRKAIVYKALERERKVAEGMHAEFIAAMNVRLAQVSLITDTAKVIDKAG
ISPLPSSPNYILNFVGGFILALFGGIAMAFAVAFLDDRAKSAYDVETVIGLPLLGVIPRIKRLSSAEKAQVAASNADRAS
TEAFRTLYSTLKINNVSKDAKVILATSTTPSEGKSFVISNLAFTCALNGEKCIIIDADLRLPALAKVLGISASKGLVSYI
EEGDSLDDVIIKDYFQNLDVLVCERRAKNPSQMLNSEEFVSMIESFREKYDKVFIDSPPIGAVSDAISLLPEVDGVLYVI
KFNTAKRKVVRRCVRRMMESNVPILGAVMNMVNTGAVSGYSINYYDKNYQNYYMTPPEIENQQEGRRQPPEVSHSDGEEK
NS
>gnl|bykdb|A0A2V2SDV4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=712 residues).
MDPIKAAAPQDSKLHFLDYWRIIRIRKAIILAVFLLVVITTVVVTFIYPESFSGTARIRVERDQSDISGVLQGQAFPSSY
DPYYINTEFELIQSEVILQPVITKLDLNKVWGAKYGPNGAPLQSTDTMKLLQARMGLQPVRNTSLIEIRVTTDKPEEAAK
LANEIAQAYCDYRVEHRKQMTMGGVDALEKKFTEQQGKVSEAQSNVDVLRFKLQISDPVVTENTPGTLMTGDTLRRFESL
RIEGLRELVSQQTLLDKLLAFSPKDVVNVLPTVIPDATLTSWLEQRNMLQQRFIALTNILGERHADVVTVQSQLDDLNAK
IAAKATGILQGVQTRVAAVKDSLAKLEHEVDQAMTNDLVKAVQSQPYFEAKRKVEEAETKLKLLTMKIYTEKLDNELPKT
AMAFITTHAVPDAHAVRPNKPFNIALGIIVGLVVGVGLAFFIEYLDTSVKTIDDVERSLNSPVLGVIPQNVGAILDEGAE
SPHAEAYRVLRTNLLFSRKDDKLNTVAIVSAGAGEGKSTTVFNLAAVFAQGGQRVLIVDSDLRRPTLHKMLRVSNHIGLT
NYLLKQNTVEEVIQTTSLPTLDFMASGKLPSSSLGILNSPQMKELIGQLKQHYDFVFFDSPPVMGVSDASIIASEVDMTL
QVIQYRRYPQPLNIRAKQLIEKVGGNLVGIVLNNINMSQDENYYYYSGYYHEEGTNDEEQEAAPGGPASQKS
>gnl|bykdb|A0A2V5PK75 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=711 residues).
MDPLKVPASQETKLHFLDYWRIIRIRKTVILAVFLLVVITATLVTFILPESYSSKARIDSPDISGIAKRMPTAGYDPYFI
QTEFETIQSERVLGKVIDKLELNDDWGKKYHGGVKLKTPDTIVMLKGRMDLRPVRNTKFIEIVVYSENKDEAARLANAIA
EAYQEHRQEQREKLSQGGIDAMEKRLKEQEEKVAKKAEEVEKLREELQVPDSMSLEAAPVQLLSAETIHKVESLRIENEA
DFVKQSTLLNKLKSLKYQELTQVLPTTVADSLLSSLLEQKNMTEQALVIRQKEYGDKHVEVIKLQRQLDDLQDKIAKRVE
GIITSLEARVAAVQTNLALLQAQVDKATANDIGNSKRWRPYFDKKRELDEQQRFRQILTMKIASEKIDQKLPKTLMVEIM
DKAEPGTKPVKPNKALNIALGIIIGLVVGIGLAFFIEYLDTSVKTIDDVERSLQSPVLGVIPQNVGLILDEGVDSPHAEA
YRVLRTNLLFSRKDDKLNSVAVVSAGAGEGKSTTVFNLACVFAQSRQRVLIVDSDLRRPTLHKMLRVPNDLGLTNYLLKQ
NSLEDVIRTTPLPTLDFLASGKLPSSSLGILSSAQMKELINELKQRYDFVFFDSPPIMGVSDASILASEVDMTLQVIQYR
RYPQPMNVRAKQLIEKVGGNLVGIVLNNINMSQDESYYYYSGYYHDYYSVNEDQESAARPDEPAGDKARRA
>gnl|bykdb|A0A2V5PST3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=918 residues).
MRPPYNMRTYFPENDTQRPALPDSSESDYAYYGSEEERVQLLDYWKNLVKRRRIIIQIFIIFLLVGAYFTFTATPVYKAT
ATLKIEPINPMVTGVTGVGESGARTAEGGGPYDYYQTQYKLLASSALAARVIADLRLDSNKIFTGASITSDNPIKRVRSW
ILGTLNSLISPVAKFFRESRQESAESDTPDAAARGGNLVDRQETDKNKPVVSRGLVGHYMSFLQVNSIEKTRLVEIAFVT
PNPALSQKLADAHIKAFIRMNLEGRFQLTKEARDFLDIKNAELKARLERAEAELNRFRQTHGVVSIEKGENIVIDRLVDL
NRNLTTARAQRLEAESLNSVVQNKSTQYLSQVLTQGMIPTLRSTLLTLEAEKIKQSTVFKPDHPRMIELNQQIKEATQSL
NTEINNVVRGIRENYVAARAKEQALEVETGKQQQAALNLKEVGVQYAVLQEEVNVNKNLYDSILKRLNETTISNDIAVSN
MQITQSAERPEFPNSPNIPIDLTMYAAMGLFIGAGLAFFLEYLNSRLETPEHVWRAVDLSTFGVVPDLASLNRPLISYQP
VSSGKPKRIAQLQAQQKTSNGKDLIVSYHPLSIFSESYRTIRTALLLSEPEATRKVILLTSPSPGEGKTATTLNLGIALA
QDSFKVLIIDADLRRGSCHSRLGIGNHRGLSNLLAGNVSIEEVVQRTSIAGLSVLTRGACPPNPTELLRMRKMKEILTGL
GGSFDFILIDSSPAIAVSDPVILSNVADGVILVFHAQKTTAASARKTKERFDAIRAPILGVILNGINLEDPDYAYYRHYY
GSDYGTVAAAENGNGGEHTDVEVLMNDGPFEKDPWPKIAASEIVPQNFFDHIVSKLRDAVGPMAGLIVEDHISLLGEARN
RFPKNRLQELFDRICEEILDDKLKNDFQQSMQEELRVL
>gnl|bykdb|A0A2V5PXM3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=663 residues).
MVAAIGTTTYLLRAPKIYASKLVLQVEQEEQKILNIQRVQQEDPQSLEFLKTVEQTFESRSLFERVLDTNNLATDPRFLK
IDDGAPRPTREKLVTRLSKMVDAKLRKGTRLIDVKVEHTSPEMAALIANSLLNFLRNEEKRLKVKLEQSERAMQEYKEQT
KSVSLEDRQNVVVEKLKELNQKVTEAKSLRILHETSYNQALQFSNNPAALLFLPAVANDPTVTDIRGNVGRLESDLANLR
QRYKEKHPKYIQTASQLVEWKNTLTNAVLNVPQVVRSLYESARTAEAALETALREQESAALELSSQALHYSSLSREVDSD
RALYEAVLNRIKETALTKEIKPGKVRVIQHAEVPELPAKPEKLRVILLGLLAGLGSGLLLALFLNSLDRSLKTVDQTEEY
LGIPVLSAIPKFASVAGDQRKLINAEDAESGEAEAFRTLRTAISMLGRKEERRVFLFTSAVPSEGKTFCSLNFAISLAQQ
GLRTLIIDCDLRRPMVENTLQNNNQRGFGLTDYLTGQKDFKAVVHASGSENFFYIPAGSHAPNPAELLARTGIDGLIDEA
LLHFERVIIDSAPVHAVSDTLLILDRVQTLCLVVRSRKTPRNSVLRAVQMLNEAGAPLAGVILNLIPRSGGGYGYYYYDS
YYAYGYYGKYGHGQKEKARAAAA
>gnl|bykdb|A0A2V5TNH4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=730 residues).
MEAAKTNSNPVETKLHFLDYWRIIRIRKTVILAVFLLVVLTTTAVTFILPESWSSTVRIAVEKDVSDINPIGFAQNNSAY
DPFFIQTEFEKIRSRKVLYKVIENLKLNERWGGRYNNNIPLKTPETFDILQGKIDVRQTRNTSLIEIRVYSDAKEKEKPA
QEAAEIANEIANVYRDTRLELKQEMSRKGIQVLREELQQNEEKVKAAEAEVDQLGKEYKVSNGSLEGATLEPQTVRSLEE
QRIRVEAEFSGLAGLLNGLLKLREEKGNTELRKSILTAINDELLSKLMMDLSTTEANLAKLKETLGPENSDFKAMAAVQA
NLDTNINQRIEGMLAGLKLKVDAFRLHLDSLAGAVDHARTNDAFMTEQYRPYFKAKRRLDDLTKLRDAVHLRILQETVDA
ALPKTSIVEITDQAEPGRKPVSPSFKLNIALGIIVGLIVGISLAFFIEYLDTSVKTIDDVERALQAPVLGVIPQNVSSLI
LEGSESPHAEAYRVLRTNVLFSRKREDANSLTVVSGGAGEGKSTTIFNLAVVFAQNGQRALLVDSDLRRPSLHKLLNVSN
SVGLTSYLLRQNTLEEVIQTTSIPTLDFLPSGKLPSSSLGILNSAQMKDFIKEAKRRYDFVFFDSPPIMGVSDASILASE
VDLSLLVIQYRKYPQAMTIRAKQMVEKVGGALLGVVLNNINISQDSYYYYYSGYYYDYYAKREEEPPAKNNGEKKTPAGE
RAQLDLKQKY
>gnl|bykdb|A0A2V5UHJ2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=1067 residues).
MEQVNQPSPYFIRRTLRPENQTIDLHEFSVVEDQVLPLRDYWLIIKRHRWLILSCALALFIGATLYTFTRTPLYTADATL
LIERKAPQILKLQDARADSVDYNDYNNEFYKTQYEILKSRALAERVVRDEGLESHPLFGGGKTNDAAKEGLVAGFWKELK
NWAKGFMPATPTPSTPDPIPLSTRLAGSYLLMLEVRPVVSTSLVVIKFTTPDPALSARLANAHASSYVRYGIDLRSQTNS
EASEFLQEKLTELKERVQQSEAALNSYRKEKGIISVDDKSNVIIERLLDLNKGLTAAEGDRIAWEAQVRAARGRNADEVP
SVRNSAVIGSLKAELGKFEAEYASLAKEFKAGYPPLDNVKTRLEETRRHLNSEIDKEVKGIEAGFAAARNKESELRVAME
DQKKATLNLKDSAVQYAILAREVDTNKQLYDGVLQRLKEIGVAAEVRTSNIYVMGKALPPGSPSYPDKRRSMLLGVLLGL
AAGIGLAFFLEQLDNTLKSPEEAERYLRLPSLAMVPDFVSVNGTNGSYVSRLLKSAQAELPVSARKAAKAKHADSSVLLD
HHSLSVVAEAYRSFRSALLLSQAGGPPHTILVTSAARGEGKTTTLVNSAIVFAQLGIRVLIIDADLRRPRCHALLRMENL
AGLSDLLAGQIELQSAIRPTSAENLSFISAGALPPNPAELLGSKKMHDLLEQLREQFEFIFVDSSPLMAVSDAVFLSTMV
DGTLLVINRRTPKPLLRKARARLTTPHSKILGMLLNRINIHNNEYGGYYQQYYEYYSQDPPAITDNAPALSENGHGRLSR
RSRLNGSFPVTLKPVASEKSSNGVSTGALDVVRAKLGEAMGPMASLVLRDSIRALGESSESFPEAKLEVLVQHVSQEILD
DYQRQRFEEETLKEIKKTTEQHGAAQPDGPVKADSAISKKKPNGTAVDNPSLTSEPAAIQEPRDGADGATASGAASISEK
TSEALPHRPSKNPAAIPKPATKKTMNKESREELSPEFLKLVIVRLTQAMGPIAPLVLREHISALGETLESFPQARLEELV
QRLCKEIVTDSFRQQFEEEMAKLTSDV
>gnl|bykdb|A0A2V5URB2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=812 residues).
MSSISHLPVQSWSPTAFIGFSQPSCTSGPVSLLLDNKEGPMKEISPHRARATMLLEDADLVSEPRLIESDEAPSLRDYWQ
IVRKHKWKILACFLAAVVITAIIVFSMTPIYTATATLLIERKAPQVVKIQQVLSESIEADERSYYESQYEMLKSRSLAAE
VIKGQGLDRNPQFTGQARHKNFAAELWSRATAWLNSLSSQPVTANAPDVYGINSQLIDAYQGMVEIEPLKRSRLVRISIS
SADPVLAASVANAHAIAYVRQGLKLGSQANEEARKFLETKLAELKDRVQKSEEALNHFRRAKGIISLNDKENIVVDRLAD
LNKRLTEAEAERIGLEAQARLIKRRDYDSLPAVISNSLIQSLRAQVVQLESEHAKLAAQFLPGYPRLAQVKAQLQETRSK
LAQQIRSVVEGINSAYLAAAGKERALKLQMDKQKSDALALKDASVEYAILARETNTNSQLYDGVLERFKEINVAGEIPAS
NISILDRAEIPRQPSQPQKRRNLMLGALLGLMGGLGLALLLEHLNNTLRTPDEVERYLRLPNLAIVPDFYRLPNHRNGQK
SLIHYDKYNKVKFDNKLCLPSKKSSLSDRRISVVTESYRKLRAAIFLSRPEAPPKTILFTSGTASEGKTITVANTAIMFA
RLGNRVLLMDADLRRPTCHKALKVQGATGLADYLAGQEELDKVIKLTSIPNLWILNGGSVPPSPTELIGSKKMQDTLALL
KESYDFIFIDSPPIMPVSDAVVLSTLTDGMIFVVRGQNTPKHIVREAISQLGNNRSKILGVVLNRVDVRSAEYRDYYRYY
NPEFYYPSARLT
>gnl|bykdb|A0A2V5X5Q6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=734 residues).
METAKTNSNPVETKLHFLDYWRIIRIRKTVILAVFLLVVLTTTAVTFILPESWSSTVRIAVEKDVSDINPIGFTQNNSAY
DPFFIRTEFEKIRSRKVLYKVIENLRLNERWGERYNNNIPLKTPETFDILHGKIDVRETRNTSLIEIRVYSDAKEKDNPA
QEAAKIANEIANVYRDTRLELKQEMSRKGIKVLKQELEQNDEKVKAAEIAVDQLRKEYKISDIQPEGAYAYSTLEPQTVR
SLEEQRIRVEADYSGLAGLLNGLLKLREEHGDSELRKSILTAINDELLSKLMTDLSTTEANLAKLNAGLGPRNPEFIAMA
AMQANLDTNINQRINGILGGLKLKVDAFKLNLDTLASAVDHARTNDAFMTEQYRPYFKAKRKLDDLQKLRDAVHLRILQE
TVDAALPKTSIVEITDNAEPGRRPVSPNFKLNIALGIIVGLIVGIGLAFFIEYLDTSVKTIDDVERALQAPVLGVIPQNV
SSLILEGPESPHAEAYRVLRTNVLFSRKREDANSLTVVSGGAGEGKSTTIFNLAVVFAQNGQRALLVDSDLRRPSLHKLL
NVSNSVGLTNYLLRQNTLEEVIQTTSIPTLDFLPSGKLPSSSLGILNSTQMKDFIKEAKRRYDFVFFDSPPIMGVSDASI
LASEVDLSVLVIQYRKYPQAMTIRAKQMVEKVGGAMLGVVLNNINISQDSYYYYYSGYYYDYYAKREEEPAAKNNGEKKK
PAGERAQLDLKQKY
>gnl|bykdb|A0A2V6EA09 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=716 residues).
MAHNDEVKLHFLDYWRVVRVRWGLISLAFFLVLITAAIVTYFQPREYKASAFIEVKSTAENPRIFGNDLHQPVHDPELAP
TVFQVIQRTGILYPVIDDLKLQDKWGKDLGRPSREQTYKLLLSRLDVEEVRNTDLLQISVFDANPQEAADIANKIVAVYQ
DKRVEEEKEIMNRGVATMNEQVAREQKAVSDAAAEVARIRDQEHIIDLNPEGMEDTQTAVNSIVLKQEEGVNEAEMTIEA
LGSRLEQIRKLKGEELMRMLATLNIQDPTIQKILPNYQEAVAQDAFFLNSGLGENHPKVKALRATKAVYAKQLEEQMASI
RSALEKNLKTAQTTRERMDKRLAEINTRQLATKTLSANYVRAKNAYIKERLLLDGIRMRAQTQTMELAMPRIAVSVKQVA
EPPNFPARPRVVLNLALGALVGLMIGLGLAFFIEYLDTSVKTMEDVENLLGLPVLAIIPKNIKLLHREAGDTPDAEAYRI
LRTNIEFNRKNPEANTISLVSGGPGEGKSTTIANLAFVCAQGGYSTLIVDADLRRPIQHEFFGVSNTAGLTSYLTTEMPL
EKVILPTAVENLSILPSGVLPADAVGILNSQRMSDTIAELKSRYDLIFFDSPPMLGVSDASVLASEVDETIIVVQHRRFP
RAMLTRVKQAILSVGGTLLGVVLNDVDLKHDQNYYYYTHYYAYYQPRGKETRRGRSRKAAATVAHNGASGSDEDEY
>gnl|bykdb|A0A2V6F8A1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=731 residues).
MEAPKTNSNPVETKLHFLDYWRIIRIRKTVILAVFLLVVLTTTAVTFILPESWSSMVRIAVEKDISDISPLGITQNSTQY
DPFFLQTEFEKIRSQKVLYKVIDNLKLNERWGERYNNGVALSKAETFDVLKGKIDVRQTRNTSLIEIRVYSDAKDKPAQE
AAEIANQIATVYRDTQLGLKQEMSQKGIEVLRKELSQNDEKIKEAEAKVDELRKEYSISDISAEGPYAISTLEPQTVRSL
EEQRIRAEAEFSGLAGMLNGLLQLRADKGDAELRKSILTAMNDELLSKLMMDLATTEANLAKLKETLGPQHPDFKGVAAM
QAHLDEEINRRINGILGGLKVRVDAFKANLDTLAKSVDDARKKDADMTEKYRPYFEAKRRLDNLQKLRDAVHLRVLQETV
DAALPKTSIVEITDHAEPGRKPVSPDFKLNIILGILVGLIVGVGLAFFIEYLDTSVKTIDDVERALQAPVLGVIPQNVGS
LIQEGPESPHAEAYRVLRTNVLFSRKREDANSITVVSGGAGEGKSTTIFNLGVVFAQNGQRVLLVDSDLRRPSLHKLLNV
SNAVGLTNYLLRQNTLEQVIQTTSIPTLDFLPSGKLPSSSLGILNSVQMKDFIKEAKKRYDFVFFDSPPIMGVSDASILA
SEVDLALLVIQYRKYPQAMTLRAKQMVEKVGGTMLGVVLNNINISQDSYYYYYSGYYYDYYSKREEEPSKNNGEKKKPAG
ERAQLDLKQKY
>gnl|bykdb|A0A2V6GQI7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=714 residues).
MAHNDEVKLHFLDYWRVVRVRWGLISLAFFLVLITAAIVTYFQPREYKASAFIEVKSTAENPRIFGNDLHQPVHDPELAP
TVFQVIQRTGILYPVIDDLKLQDKWGKDLGRPSREQTYKLLLRRLDVEEVRNTDLLQISVFDANPQEAADIANKIVAVYQ
DKRVEEEKEIMNRGVATMNEQVAREQKAVSDAAAEVARIRDQEHIIDLNPEGMEDSQTAVNSIVLKQEEGVNEAEMTIEA
LGSRLEQIRKLKGEELMRMLATLNIQDPTIQKILPNYQETVAQDAFFLNSGLGENHPKVKALRATKAVYAKQLEEQMASI
RSALEKNLKTAQTTRERMDKRLSEINTRQLATKTLSANYVRAKNAYIKERLLLDGIRMRAQTQTMELAMPRIAVSVKQVA
EPPNFPARPRVVLNLALGALVGLMIGLGLAFFIEYLDTSVKTMEDVENLLGLPVLAIIPKNIKLLHREAGDTPDAEAYRI
LRTNIEFNRKNPEANTISLVSGGPGEGKSTTIANLAFVCAQGGYSTLIVDADLRRPIQHEFFGVSNTAGLTSYLTTEMPL
EKVILPTAVENLSILPSGVLPADAVGILNSQRMSDTIAELKSRYDLIFFDSPPMLGVSDASVLASEVDETIIVVQHRRFP
RAMLTRVKQAILSVGGTLLGVVLNDVDLKHDQNYYYYTHYYAYYQPRGKETRRGRSRKAAATVAHNGASDSDEY
>gnl|bykdb|A0A2V6JLK8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=729 residues).
MGGSPPKGPTGMAHNEEVKLHFLDYWRVIRIRWVLVLLAFLLVLITAAIFTYFQPREYKADVFVEVKSTAENPRIFGQGD
PNQPIHDPQLAPTVYQVIQRTGILYPVIEQLKLQDKWARDGRPPSREIAYQMLRNRLDVDEVRNTDLLQISVYDGSPQLA
ADIANKIVSVYQDRRVEEEKEILNRAVTAMNEEVGKQQKRVEEAGAEMAKIRDEEHIVDLNPEGTEDSQAPVNSIVVKQE
AEVNDAETKVTTLSSKLAQIENLKGDDLMRMLPTLDVQDPTVQKILPNYQDTVAQEALLLNSGLGEDHPKVKSVRAARQV
YTRQLEQQVGIIRQGLERNLKTAQGTRDELRKRLEQINAKQLQTKNLSANYARAKNAYIKEKTLFDGVRTRAQTQTMEMA
MPRFAVSVKQVAEAPSYPARPRVGLNLTLGMLVGLVIGIGLAFFIEYLDTSVKTMDDVESLLGVPVLAIIPKNINLLHKA
EGDTPDAEAYRILRTNIEFNRANPEANTISLVSGGPGEGKSTTIANLAFICAQGGYSTLIVDADLRRPVQHLLFDLSNEI
GLTNYLTTDMDLDQAILPTNVENLSILPSGILPSDAVGILNSQRMSDTIAQLKMRYDIVFFDSPPILGVSDASVIASEVD
QTVIVVQHRRFPRAMLTRVKQAILGVGGTVLGVVLNNVDLKHDQNYYYYTNYYGYYQPRDKETHRRGRQKSRVAANGSAD
NGHIDTDEY
>gnl|bykdb|A0A2W5Z1A5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Chthoniobacterales bacterium] (length=717 residues).
MAETDEGKLHFLDYWRVVRVRWVLILLAFSLVLITAAVVTYFQPREYQSSAFIEVRSTAQNPHIFSQIDPSQPVHDPTLA
PTVFQVIQRTGILYPVIDELKLQEKWANHSAGPLSREQTYAILRGKLEVDEVRNTNLLQISVFDSNPQLAADIVNKIIAV
YQDKRVEEEKDILNRAVGSMNEEVDKQQKKVDDAAVEVARIRDTEHIIDLNPEGTEDSKTPLDTVVVKQEAEVNDVEAKV
ATLQSQLSQIEHLKGEDLMRMFAALNIQDPTTLKILPNYQDAVAQEASLLNSGLGENHPKVKALRAQKQVFARQLQEQVG
IVRSALEKNLKTAEKTRDELRARLNEINEKQLSTKNLSANYTRAKNNYIKEKLLLDSVRQRAQTQTMEMAMPRVAVSVKQ
VAEPPTFPARPRVGLNLALGGLIGLGIGLGLAFFIEYLDTSVKTMEDVETLLGVPVLAIIPKNVTLLHHEIGDSPDAEAY
RILRTNIEFNRRNPEANTISIASGGPGEGKSTTVTNLGYICAQGGYSTLIVDADLRRPVQHMHFDLDNKIGLSNYLTSNM
RIEEVIRPTSVENLSLLPSGVIPSDAVGILNSQKMSDLIAELKTRYDIIFFDSPPMLGVSDASVLASEVDQTIIVVQHRR
FPRAMLTRVKQAITGSGGTVLGVVLNNVDLRHDQNYYYYTNYYGYYQPQDRQSRRSRSRAGVGAESNGASDNGRDEY
>gnl|bykdb|A0A317ZP96 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Coraliomargarita sp. WN38] (length=766 residues).
MKNEYVRGAPDPNAGGYAGGYGYGSYGYGGGYGYGGAGYGYGGGYGGGGGGPQRSFKDYFLMFRERIWYLIVAFFIIFSG
SILYTFNKTKVYTSAATVQLLRDDPSALGDTVEMEQNQIRSAEDLNTQISLLESGTIIQGVEQRLQDDMRKRFMAPYTDA
LSLRGPLTPTEVLGRNRKIIPRRMSLMINIAYSHPDPIVAAEVANLFAKEFIDYNLKLNIDSSMKAVEDLRIRADQQKDR
VEELEFKLADYREQKNAVSLDSQENIAREQLGSLNTMKLNNKNILDNLETKWNLIENYKREGKDLWELSFIAEQERVASL
LERISGARISISSLSKRYREKHPVMIQQIQTLQEAEMELESAVKNAVDKIYAGYIEAQKNYEIATKRLVEKEKELIELSR
TRVEYNSLLRDLEVEQNFYQALNSRMTTEKAQVNLKNPNARIVDEAYPPADDNPSSPNVVMNLAAGFFGGLAVGTALVFA
VAFLDDRVKSAFDIEGTIGLPMLGVIPRIKKLDTNTKAQAVASNVDRHVTETFRTIHSALKLNDESKNAKVIITTSTVPG
EGKSFISSNMALTFANHGEKTLLLDGDLRLPNVARSLQLENEKGLLDHVEQGKDLDDVIVKEVYPNLDVLPSGGKSKNPT
QILNSASFESMLAELRDRYDRIIIDTPPLAAVSDALNLLPLVDGILYVIKFNTVKRKTAVVNVRRLWESNTPVFGAVLNN
ITSTLSSYYYSQYSDKSYQDYYIQQEEEFEHELEGEVEPEELQTKS
>gnl|bykdb|A0A348S017 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=732 residues).
MESNNQHSMENQSVAENLNLRHYWHIVLERRWLVIVAFISVFILSILYLFKATPIYEAKTVLQINKESTSMMDGATPIVF
NSNDQEYLQTQYKNLLSRSLIESVVRDLGLDEEGRYAQSQNVINAVRNDISISPVRLSRLVEISVQHPSPRVAAQISNKL
LDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRFREKNKMPSLEESQDTVSKALFAASQSHQLANDEAEQ
AQKAIDEVDKMIREAGESGQLLDLSQIPFVASSEIIKTIRANLVMAKTDLAALQVKYLEKWPAVIEAKERIVKLTEEIQK
VAQDEIDLLREQARYQQARAVRALDSLNARQADMNRLNQLKVEYDNLVMQKMQSEELYTSMLAKTKEMDLSTKDMMQNLV
VVDKAFEPINPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLVERDMQAHL
HPQSNAAEGFRTVRAAISLVHKADKFKVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAFQMQSPI
GISSYLTDQVSDIAEITQKTEVPNLDIICCGAVPNNPSELVGSTRMGELLEAVRGKYDRIFVDCPPVSAVSDPLMIASRS
DGIVFVSKFNKIRRDHARKTIQRIQDAGIYILGTVINDIDFEGKDSYYYSYYYYQNRYYASYYSNEKKLEPNKKSKSVVQ
LDKTAKKSESEV
>gnl|bykdb|A0A349GXM8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=762 residues).
MATPRPGGGVSTEENKIDFRIYLSVMLFRWQLIALCFLYTMLGAVAYLYLAPKTYESNTKIMIYRDPLLTVSNEGAQWTS
LHTHTYMLNNEKLHERVMNKLAEAWADRLGGRHRMNPKIAISQVRGINPMVSVAVQSRNKDYTAAFLSLLIDEHREEWQT
VQRQARNSAGGMLEQELARLDQKIRTAEDDLIEYQRLHDIARVEARGTMESRHLSALMERRNQLTTELMLLEAQYPALDG
ANAAVISDVARLTRATGEIKPSESSRDEEEAPVPGGETKSAKEDAAQQTDETIQGFQNLRVRLMRLEADQAELLKVLKDD
HPRLKAVRDEIKSIQDQLASMAEVQMRNLRDRHRALSIQLNAIETAEYKWQAKNLTASQRQAEYSRLRSEVGRLAAHYNT
LYTRLHDMRVSEELKSEHFVPEDITTREDPVWPDPLKILMAALAGGLGLGFGLAFLAQVVDNKVQTIKDVENILGVRFLG
GIPYWAHSQLESSIRPIVTEEHSTGAIEAYRALRTSVLAELAKKHEKILMITSADSREGKTLTALNLSIMVVQMGKRVLL
VDMDLRRGRIHRSLGLDREPGVTDVLRHGKSLREVIQPARIENLFVAPSGGDIDDSAELLQTVDVRGFFVDVQDDYDYIF
VDTSPVLRVTDTVILASQGIGQVLYVARVNFTPKPMIRYSLDMLKDANILGLVMNSIEMHKISSLYYAYQYPNYAYYSNA
YAYGYDYYYDEKGGNRRSRRQIRWRKQLEHAGAWIRKTLMPM
>gnl|bykdb|A0A350EWA4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=729 residues).
MDSFKQDQPTASLHFLDYWRIIRIRKTVILAVFLLVVLTTTLVTFLLPESYSSTVTIEVKKDSSTLDRIGGPTAVQGFDP
YFLQTEFEKIQSKTVLYQVITNLNLADFYRDARKLEVNLKPEEAYMLLKGDLSVSQMRNTELIEITVFNENKAMARNIAN
EIAKVYREWRMNLSDERFQEGFDAINQQLEKAESDLKESEAEVNRLRASLEITDIDEASSRNEQFFDMQTIQQFRNKHDL
EKLEYEKMMKRLHGMEALTSIDQLKVALPTSFPDSALIVNFAGMFQSEADAERQLAGLLGQFGRDHPTVMSAQAELDKAR
ETIKSRVEAMLIGQKNDALALSNNLVELERTIAAKEAEFRQKSSNIMPYISAKEEYLRRRNVRDSVAMKIAQEKINYALN
STFIVGVINPAEEGLRPVRPNKTLNIALGVIVGLVVGVGLAFFIEYLDTSVKTIDDVERALQAHVLGVIPQNVGSLLDEG
PDSPHAEAYRVLRTNILFSRKSEDQNTITVVSGGAGEGKSTTLFNLACIFAQNGARVLIVDSDLRRPSIHKILRVSNSVG
LTNYLLGQQPIEEVVQTSSLPSLDVMPSGKLPSSSMGILSSVRMKQLVKELKSRYDFVFFDSPPIMGVSDASVLASEVDL
TLQVIQYRRYPQPMTIRAKQMIEKVGGNLLGVVLNNINMAQDENYYYYSGYYYDYYSKQNDDDGDQSGRKNGHPATKDEP
ASRLDLKKY
>gnl|bykdb|A0A350I3V2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=732 residues).
MESNNQHSMENQSVAENLNLRHYWHIVLERRWLVIVAFISVFILSILYLFKATPIYEAKTVLQINKESTSMMDGATPIVF
NSNDQEYLQTQYKNLLSRSLIESVVRDLGLDEEGRYAQSQNVINAVRNDITISPVRLSRLVEISVQHPSPRVAAQMSNKL
LDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRFREKNKMPSLEESQDTVSKALFAASQSHQLANDEAEQ
AQKAIDEVDKMIREAGESGQLLDLSQIPFVASSEIIKTIRANLVMAKTDLAALQVKYLEKWPAVIEAKERIVKLTEEIQK
VAQDEIDLLREQARYQQARAVRALDSLNARQADMNRLNQLKVEYDNLVMQKMQSEELYTSMLAKTKEMDLSTKDMMQNLV
VVDKAFEPINPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLVERDMQAHL
HPQSNAAEGFRTVRAAISLVHKADKFKVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAFQMQSPI
GISSYLTDQVSDIAEITQKTEVPNLDIICCGAVPNNPSELVGSTRMGELLEAVRGKYDRIFVDCPPVSAVSDPLMIASRS
DGIVFVSKFNKIRRDHARKTIQRIQDAGIYILGTVINDIDFEGKDSYYYSYYYYQNRYYASYYSNEKKLEPNKKSKSVVQ
LDKTAKKSESEV
>gnl|bykdb|A0A351MR11 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=759 residues).
MPSSYILRQRDDGNTSYSGGYGGYGGYGAYGESRYGGYGSVPAPGYGQAAGVNPLANYMLMLRERMWYLVLTVLVFVTAA
LIYTVNATPEYRASGRLKVYKYAPNITGRGAGEELYAIMSADDFNTAIEVMKSSGIIEAVERRLTTSERKAVLEPYQSGN
IFSGPLTSQEVFGRQRGIAAQRMTMIVNVEFTHPDRDLSRQVCRLFCESIQKNSEDERLTVTNPLVEKARVEIESLEERL
NRLYLDKNELVGRERMLAIVKDTNTLGSERGALVKDREELRRQIDELAIIWEQIEQFKKEGKDLVLIPMVKSDDRVAALY
NRVSELQVTIETLEKKYTESHPTLRISREQLDVTKRELKTAIEMSVNRLAGLRSSSQQRLIAAERSLSGKEAEIARLQGA
NIELERIEKEIRLGEDFLNRLKLSYEDAKLRTSTTGTSTSVRILDTPVVSERPINKNYYLNVFVGIGLGLASGVGLVVLL
GVFDDRVKSAVDIEGGLGLPLVGTVPRTTDTYGPDRALLARQTKDKMAIESLRAIHSVMKINPSAANAKVLLTTSTRPGE
GKTFVTTNIALTFAQHGERVLVVDADLRLPNVAPSMGIETDNGISKYFNNEITLDEAILKDFEPNLDILPVGGICKNPTQ
VINSPRFDELIRELRTRYDRIFIDSPPLGAVSDALHLVPKVDGVIYVVRFNLVKKRNAMSCIARLREAGVPIVGAVLNSM
ATRLAAFYTNSYDASYSKYYTDAADQGAEKPAPKKDPVV
>gnl|bykdb|A0A351WE84 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=726 residues).
METSEATRASLVILGCGVKFMADSQQDTALHFLDYWRVIKSRKEIVMAVTLLIVITGVAVTFMQPKKYSSTVRILVREDS
MDVDVFERQMIQGYNPFFLRTQERILKSTPLLYAVIDNLNLQAVWGQQYNDDKSPITKEDALATLSSSIKIEQDRDTSLI
NISVTQEDRELAARIANEMAAVYREQRLDVKRSELRRAIEVLDNEVQKQQEKVDQAESELERIRQEVGVSFLGQGFRADK
VRLQQLEADRIASRVDMLVRKARLNQLESLEGTELMNASSYVVMDQSIASIRQQLIDTEVALKLMLENMGVNHPDVKRLQ
AGVDELKKKLNESLVGLKIGLNADYEVAKAKFDALEAELQAAKHSDIEDEKKKFLPFDRAERNVIIQRDILNALRARITQ
QGIEVEVPRTPVEVVEPAEPANKPSSPLVMLNILLSIFLGFGAGIGLAYFIEYLDTSVRTVDDVEQFLGLPVLGVIPQKI
RPLIHEGPESPHGEPYRVLRTNMQFSNKGIHGGAFAVISGGVGEGKSTTLFNLAYTCAQLGYKTIVVDSDLRRPVQHSIL
SMSNRIGLTNVLMKDSTLEECVKPTIVPNLSFLPSGRLPRSMMGIIDSQRMRELVKDLKSRYDYVFFDSPPIIGITDASI
LASEVDGVLLVVQYRKYPRVISSRAKRMVENVGGKLLGVVLNNINIMRDDYYYYYHASYTQYNPDGQEKVPAKTIAASAD
GKDSLF
>gnl|bykdb|A0A352XLN9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=717 residues).
MQPQSSNSEAALHAVDYWQVIKNRYGVILITLLLVFMTAAVITYVMPRKFESRAVVQVNPSNRFGTAFGDDNNSQIQMTP
QFFATQFEIIRSQMTLRRVVDKLRLTNRWNVTEEDALMTLTGIVQAQNIRGTDLIEITVLHPGAEDARDIAVEVYEAYKA
RRVQEETDLSENASKQLEQAVLEHSDVVEEKRKQRDNLQRRAPSVVRDFLTGNAGNGYQSMQANVESQVEAAKTTLAELD
SMIASIDRLSADEVIRYAANLEVAGQDLKSLFPEYQEQVRMLSGMQVQGLGPRHPNVLAQESTVDSLFKQLQASVVSFKD
SLKIKRETKNVELVELNNRLVEVKDMSKENIIAMTQIQNVHDEFTTQQKLLDEMKQKLTTDRINLRQPQNIIQLHEEPVV
ARFPSSPKVNIALILGAVVGLVFGIGIAFFLEYLDTSVKTLEDVERYLQVPVLAVIPKDIGVLHKQSGMSPDAEAYRILR
TNIEFNRKNPEDNSITVVSGAAGEGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFFDINNSVGLSNYLTTELMLED
VILQTPVENLFFMPSGILPADAAGILNSRRMSELIADVKQRFDLVLVDSPPILGVSDASVLASEVDLTIIVVQHRKLPRN
MLLRVKQAVENVGGHVLGVVLNNVDVRSDSQYQYYTSYYTYYAPAESELPQPQPSTSSRPATPSSTASTSNQNDTLY
>gnl|bykdb|A0A353DV86 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=727 residues).
MQSKPVPQQSDSKLHFLDYWRIIRIRKTVILAVFLLVVLTTALVTYILKPTYSSSVRIAIEKDSADITPLIGMQMSQQHD
PYWVLTEFEKIQSKVVLHPVIDALELRNRWMKRYNLKQPLTLNEAFNVLKKSIEVDQYRNTSLIEITAYSQDKEEAALIA
QEIAEQYKSVREVNLQSMANAGIDALKQQYADQNEKVRLKQADLDQLREELNISDIYSAEGSSIGMTTEPQIVLRLEQER
TVAEAKLIRFQTLFNELEAMTLDQLKNTILTAMPGNLRLTHLLNEYDTTRQALARLSAIHGPEHPERKSLYTLLEEIETQ
VTSEITGVLRGLQSQVNAAQNELNELTAAVENAKANDALKTAKYRPYFTAKRDLENLSKISDMIMIRILQETVDASLPTE
SIVEIYDPAEPNDEPVRPKKVLNIALGVLVGLIAGVGLAFFIEYLDTSVKTIDDVEQALGAPVLGVIPQNVQSLLLEGPD
SPHAEAYRVLRTNILFSKKDPKFNALTVVSGGAGEGKSTTIFNLATIFAQNDSRVLIIDSDLRRPSLHKLVGVSNAVGLT
DFLLGQKSVEEVIQTTKLDNLHFLPSGKLPSSSMGILNSQQMKDFIQDVKTRYDYVFFDSPPIMGVSDASILASEVDMAI
LVIQYRKYPQAMTIRAKQMVEKVGGNLLGVVLNNINISQDSYYYYYSGYYYDYYSKQDDSEGGSSAQPKTKSSKTASRGD
VELKNKF
>gnl|bykdb|A0A354E720 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia sp] (length=799 residues).
MTKNTAPTPPGTENTEETALSLDTVLMILRRYWFIIILAALAGGTAAYYLAGKQNYIYQKKASVLMRDSKTGSDASSERI
MAELNIDPNAANLANESLVLKSTALMNKVVEDLNLNTSYWQKKDFRELDLYHASPLLVNFEQIDKQRACTLHITPLDEKR
FTLGHPNNQGELILLEGFYGKPLTLPFATVSVHPTSLMTDAWNGKTVIVRHSPVLETANALLHGLTITRPDSKESSLLEM
TLTSSNPQKAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRLQELGASLSDVDKKLTEFKTKSDIVKDTDTTMSADFS
TSQALEKEIFDLETQIKLASTLADNLKESERKQGLISVETGLPDSGIARQIEHYNEAYLEYQKIAGSAGSQNPITVSLKD
RMNSTRAAANKALSNYRSNLDLKLNQLIDKRNSLTERLTETAIKEQEIIPLIREHKVKEELYLMLLSKEQENALAMAVTE
SNARVLEAAHGPNLPISPKTIKYVAGGTAGGALLSILAFMGVAMLNNKVNNKHDLPSVNRQPVIAELPQMSKKESRNTKL
FIQDEHSVIAECFHILRNNVDSMLPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDLRKSSLTRRLG
GSGRKGLTSILLRQNPDTAGVIRPVGEDTRGMDVLYTGPTVPNPVTLLSHPLLGQILSILKKQYDAVIIDAPPYGILADT
AILASLSDITLYTVRSGKIDKRYLTQIQQLADQGKLPNMAYIINGVNFKSASYSYYGYGYGYQYGYGAKDPQQTARKRD
>gnl|bykdb|A0A354EBD3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia sp] (length=723 residues).
VRNIDYLQVLKNRWKEVFLVFLLVLVISVVVTFLMPPSYRATSQFQIKLPKPVMDIGRGGDVVATSNVTANYIPMQYSVL
TSAEVLKVVSRKLNLAAEWGMTDEMAATNLFGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAYKQDREMRENRLV
ETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTSWRNGEHRSTLTAGMEEEEFRNAKAQAMDFERREKELASYVQE
LQRLPDDKLLDYVISSDLLNAETVGADALRKTYAEFSDKLKEKENLKSQNIGPKHPKMLALLETERILGDKLNKELIGLR
SSLKSKLEMVAASRKHWEATVAQKEEDLQKHVLQVPMYEQASRDYDAALDQLKELDSRYKDEIARLRVPREAIEMYQLPT
YPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSGVMGPDAEAYRIL
RTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNELGLTSYLLEDYPLE
EVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDMTLMVVQPRKLPL
KALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSTDGSSSGENAEASSMKKAERSGKAKELAATQSHDSE
DLY
>gnl|bykdb|A0A354T7G8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=732 residues).
MNETGSEFQKHAMDTWQVVKNRIGLITLCFILIFAAAAILTYIMPRKYRGHVEMTIERITQDINVFDRNRGDSLAFTQEY
IKTQFETITKPSTLYPVIQSLDLAKRWELPSRQAALAKLRANLETQSMLRSDFVSIDYYDQDSQLAANIANEIAKSYMEQ
RNNIETEKKQKALTVLQQQISDQEELRRLAQVRSQEARRKAGIVGDWIAGGGSSLNPGGEMRSEKDSMVISREQALMLAD
QDTLTLQAEIDEIGKLSIEELIARASGLKLDNPSLASNTTEYNKLIVQREGLMNAGMGRRHPNVESLSSQIDKLKTFIEA
EARAHVQGLQNRLDGAKRKRDSFQTYNDDAKKELQDMQSLYNEYKTAKDEVTYLEDLLVKMRSRFFEEKAGIELVKSPAT
IYAEAEPEGKPAKPNVPLHLALGGVLGLMFGLGLAFFLEYMDTTVKSLDDVERHLGVPVLAVVPKGVGVLHRSSGFNPDA
EAYRILRTNIEFNRKSPDANCFSVVSGGAGEGKSTTMVNLAYVCAQGGYNVLLIDADLRRPSLHHHFDVSHATGLTNYLT
TDISLEDVVIRTQVENLFFLPSGLLPADSAGLLNSQRMVDLIADVKSRFDLVLIDSPPILGVSDASVLANEADMTMIVVQ
HRKLPRHMLMRVKQSVENAGGKVVGVVLNNVDLRSDAQYQYYTSYYTYYAPTNSPTGGAGGKTRRRKVKAETTANALTSP
RTVSRPEGEDVF
>gnl|bykdb|A0A355S8S2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=733 residues).
MPNGPERQTNASEAALHAVDYWQVLKNRYGVILLTFLLIFMTAAVITYVLPKKYESTALLQVNHSFIELDPLNGSVGQPM
TGASPSHAYIQNQFKIIESETVLNRVVESLDLTTRWNGFDQNMALLKLKSILKTEQIRNTDHIEVRIRHQNRDDARNIAK
AIAESYKEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHAIVKAVGIPYIEGVLTSGRMGQSEEAILKSAEMQQF
TAEEKKGQLENQIEQLLTLQDEELIDFAEGLQLPGSQVPVLRGRYQESRVNIAALEASGLGRKHPSVEMAYIAQSKLQED
LKSSVVVLRELLKTQLSLVNGQLVKIKDRVEDRRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKT
PITILEHPKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIPTDVGVLHKQSGMS
PDAEAYRILRTNIEFNRNNPEDNSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFFDINNSVGLSN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMI
VVQHRKLPRNMLVRVKQAVENVGGHVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSADSDPVPTVGATASATSGSALESKV
VANDSEEDEGLNY
>gnl|bykdb|A0A355VEB2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia sp] (length=735 residues).
MSAQDQQNSDRIVRNIDYLQVLKNRWKEVFLVFLLVLVISVVVTFLMPPSYRATSQFQIKLPKPVMDIGRGGDVVATSNV
TANYIPMQYSVLTSAEVLKVVSRKLNLAAEWGMTDEMAATNLFGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAY
KQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTSWRNGEHRSTLTAGMEEEEFRNAKAQAMDFE
RREKELASYVQELQRLPDDKLLDYVISSDLLNAETVGADALRKTYAEFSDKLKEKENLKSQNIGPKHPKMLALLETERIL
GDKLNKELIGLRSSLKSKLEMVAASRKHWEATVAQKEEDLQKHVLQVPMYEQASRDYDAALDQLKELDSRYKDEIARLRV
PREAIEMYQLPTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSG
VMGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNELG
LTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDM
TLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSTDGSSSGENAEASSMKKAERSGKA
KELAATQSHDSEDLY
>gnl|bykdb|A0A356NIC2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=732 residues).
MESNNQHSMENQSVAENLNLRHYWHIVLERRWLVIVAFISVFILSILYLFKATPIYEAKTVLQINKESTSMMDGATPIVF
NSNDQEYLQTQYKNLLSRSLIESVVRDLGLDEEGRYAQSLDVINAVRNDITISPVRLSRLVEISVQHPSPRVAAQMSNKL
LDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRFREKNKMPSLEESQDTVSKALFAASQSHQLANDEAEQ
AQKAIDEVDKMIREAGESGQLLDLSQIPFVASSEIIKTIRANLVMAKTDLAALQVKYLEKWPAVIEAKERIVKLTEEIQK
VAQDEIDLLREQARYQQARAVRALDSLNARQADMNRLNQLKVEYDNLVMQKMQSEELYTSMLAKTKEMDLSTKDMMQNLV
VVDKAFEPINPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLVERDMQAHL
HPQSNAAEGFRTVRAAISLVHKADKFKVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAFQMQSPI
GISSYLTDQVSDIAEITQKTEVPNLDIICCGAVPNNPSELVGSTRMGELLEAVRGKYDRIFVDCPPVSAVSDPLMIASRS
DGIVFVSKFNKIRRDHARKTIQRIQDAGIYILGTVINDIDFEGKDSYYYSYYYYQNRYYASYYSNEKKLEPNKKSKSVVQ
LDKTAKKSESEV
>gnl|bykdb|A0A356NPK0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=730 residues).
MQTKPSQQPQQQSDSKLHFLDYWRIIRIRKTVILAVFLLVVLTTAIITFLIQPTYASSVRIAIEKDNSDITPLMGLQAAQ
QHDPYWVLTEYEKIQSKKVIHPVINALGLNHKWMERFKTDTPLTTNETFQVLKNSIDVDQYRNTSLIEIKAYSKDKEEAA
LIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLTQQNKVQTKQKDLDKLREDLNISDIYSAEGSSIGMTTEPQIVMKLE
QERTVAEANLIRYETLFKELTSLTLEELRNTLLTAMPGNLRLTSLLNEFDRGHQQLSQMKAIHGPDHPQMQASNSLLLTL
NDQIKKEITGVLRGLQTQVNAARNQLTELTSAVESAKASDAEKTAEYRPYFTAKRDLENLSKISDMIMIRILQETVDAAL
PTDSIVEIYDPAEPNPDPVRPKIFLNIALGVVVGLVVGIGLAFFIEYLDTSVKTIDDVEQALDAPVLGVIPQNVHSLLME
GPDSPHAEAYRVLRTNILFSRKSEKATTLTVVSGGAGEGKSTTIFNLATVFAQNDSRILIVDSDLRRPSLHKHVGVSNAL
GLTDYLLATKSLEEVVQTTKHENLDFLPSGKLPSSSMGILNSSKMKSFIAEARKRYDYVFFDSPPIMGVSDASILASEVD
MAILVIQYRKYPQAMTVRAKQMVEKVGGNLLGVVLNNINISQDSYYYYYSGYYYDYYSKQDGDNTSSKKKSDGKSGKTSA
RGDLELKNKF
>gnl|bykdb|A0A358KGZ3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=728 residues).
MEPTSRKENSSDKLHILDYWRIIRVRIVTILLVFLLTAITTTVVTFLIPKTYMSLSRIAVEKDTSDIAPLLGMQATQSSF
DPYFISTEFEKIQSQKVLDEVVKSCELREKWKKHYGGKQLTDVEARKHLEKVIDVSQYRNTSIIELRAYDRDKNLAQQIA
QALAKEYENYRSSLQEERVKAGIDKLRERMEKTNDEITAMQANVDDLRAKLGISDAAGEDSYSIVEPEIVRRYESELITA
KGLYTQQATLLQGLQEQSLEELRESIMTANPDAQLDALIREYQTGQTTLANKSIDLGEGHPTIKSLKAAMESLNQQIDNR
IKGILAGLELRVNSSLAQVRELQKSVDDAKAKEAKVQEEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDLDLPKTSSVE
IIDKADTPLRAVRPNVPLNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALDAAVLGVIPQNVGSLMDEGDESPHA
EAYRVLRTNILFAGRKSEDQTTFTVVSGGAGEGKTTTMFNLAVVFAQMGDRILVVDSDLRRPSMHRYFKVSNTIGLTNLL
LGQNTLDEVIQTSESPNLHFIPSGKLPSSSMGVLNSAKMKEFVAEMKSRYDYVFFDAPPIMGVSDASVLASAVDLCVLVV
QYRKYPQLMTQRAKDMVIKVGGDLVGVVLNNINISQDSYYYYYSGYYYDYYYKSRETEDEPVEDKKDGKEEKLIAQADAA
GEDVNPKY
>gnl|bykdb|A0A366HAG0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseimicrobium gellanilyticum] (length=728 residues).
MATPNNLELQRHALDYWQIIRNRLGLILASFIFIFAVAAVLTYIMPRKFRGRVEMVIERKLDDARVVGNANLQDDNLAST
DSFLKTQFEIITKRRTLDRVVDKLDLLEKWNLKSKQAAAGKLIGNLDAQSSIKSDFITLDYYDEDPDLAALIANTIADSY
KETRLETDNARINKAIEGLNIQIAAKELQAKQSMERMIQLKKDLDLVTLPTSMDAKGAQDDVMTPESAMLLDTQRDVATL
QKQVRDLKAQHDQMMTLEGDELIRLAGEMKVENETIRRMGPTYQELLLKQQSLATAGLGRKHPTMRGIAGSLEQTRALLL
EAAQDYRKNLGVRITTVERQLEEAEKHNKDTRAKSLDSQAGHHEYLAAKREWETLQQDTAKLKDTKAQKEIERDGSKTPI
TVYQPAEPDTTPSKPNVKLNLLLGGIIGLMFGFGMAFFLEYLDTSVRTMDDLERTLSVPVLAVVPKGVGTLMHATGITPD
AEAYRILRTNLEFNRRDPNANCISVASGSPGEGKSTTMVNLATICAQGGYNTLIIDADMRRPRQHTFFNVPHTFGLSNYL
SSNVPLEEVVVQTQVDHLYFMPSGVMPADSAGLLNSQKFVDLLTDVKSRFDLVLIDSPPIIGVSDASVLAAEADMTIIVV
QHRKLPRQMLQRVKQTIEQVGGKVAGAVLNNVNINSDATYGYYTSYYGYYSGDGKGDGTMKAKRKTRQSTPAKGAKVKSP
RAKADEVF
>gnl|bykdb|A0A368B8C5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=732 residues).
MRNGPERQTNASEAALHAVDYWQVLKNRYGVILLTFLLIFMTAAVITYVLPKKYESTALLQVNHSFIELDPLNGSVGQPM
TGASPSHAYIQNQFKIIESERTMGRVVERLDLTTRWNNFDRNMALLKLKSILKTEQVRNTDHIEIRIRHQNRDDARDIAK
AIADSYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYIEGVLTSGRMGQSEETILRTAEMQQF
TAEEKKGQLENQIAQLLTLRDDELVDFAEGLQLPGSQVPVLRARYQESKVNIAALEASGLGRKHPSVEMAYISQEKLSED
LKSSVVVLRELLKTQLNLVDGQLEKIKDRVEDRRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKT
PITILEEAKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIPTDVGVLHKQSGMS
PDAEAYRILRTNIEFNRNNPEDNSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFFDINNSVGLSN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMI
VVQHRKLPRNMLVRVKEAVENVGGHVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSADSDPVPTVGTTASGTSAAIESAVA
ANDADKDEGLTY
>gnl|bykdb|A0A3C0DQZ7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=727 residues).
MDKIPTTDQSSDKLHILDYWRILRVRFVTILLVFLLTAVTTTVVTFLLPRTYMSLSRISVEKDSSDIAPLLGMQAGPTAF
DPYFIQTEFEKIQSQKVLDKVVEKCDLTNKWDPNEKGLDLIKAREILKKTIDVRQYRNTSIIELRAYDRDKELATKIAQS
LAEEYRGHRSSLQKQRVGEGIKALNRRMEEINKKITGLQGNVDRMRTELGISDAAGEESYSIIEPEIVRRYESELITAKG
IHTTQATLLEGLKAQSREELRASILTAHPDAQLDALIRELHTGEQTVANQSIDLGEQHPRIKGLKKVVATLEGQIDDRIK
GVLAGLELRVKSSKAQVEELQRDVDEAKQRESDMREKGREYFDAKRELANTTRIRDTILLRIMQEEVDLELPTESTVEII
DDADVPDKAIKPNIPLNISLGVVVGLILGVGLAFFIEYLDTSVKTIDDVERSLGAAVLGVIPQNVGSLLEEGDESPHAEA
YRVLRTNILFAGRKSEDQTTFSVVSGGAGEGKTTTMFNLAVVFAQQGDRCLIVDSDLRRPSMHRYLQVSNNIGLTNYLLG
QVTIDEVIQTTQIPSLHFIPSGKLPSSSMGILSSSKMREFVSEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCVLVVQY
RKYPQLMTQRAKEMVTKVGGDLVGVVLNNINISQDSYYYYYSGYYYDYYYKSREKEEENADKSEDGAKEGKLLAKADLGA
GEDKPKY
>gnl|bykdb|A0A3C1BZR1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=704 residues).
MAEESQTTALHFLDYWRVIRDRKEVILAVALLTIVTGTAYTLMMPKKFTATTQLEVREDAMDVDPFYERQASRMGYNPFF
LMTQEKIMKSRPVLTAVIRNLNLQKVWGMEFNEDKSPVAPELALQILSRSLRVEQDRDTTLMNISATSEDPKLAAEIANE
VANVYRDRRLLAKRREIQRAIDAMSNEVRKQQERVEEAESELERIRQERGISLIGRGNMSIRVEATRLNMLEGERSGARV
EMLVRKARMDQLEGLEGDRLMDAAAYIVQDPTLMGIRQQLIDSQVSLQLMLKNGVMGENHPDVLRLKGAVEELRRQLASA
LEGLKAGIKADYEVARQKYEALDEELSLIKTSDIESEGENYLPFDRAERNVSVNRDILTALRARITQTGIEVEVPRTAVE
IIEEAEAPQRPSSPLVVLNIFLSVVLGLLAGTGLAFFVEYLDVSIKTVDEVEKYLGLPVLAVIPQQSRPLTEAGQSSGQG
EAYRALRTSLALLAREGKQKIFTVISGGVGEGKSTTLFNLAYVCAEQGSKVLIIDSDLRRPVQHKMVGLANRTGMVNVLT
GDLKAEDVIQETGVPNLWMMTSGRLRRGSLGIMNNARLRALMDSLKEKYDFVLLDSPPILGVTDAAILASEADGVLLVVQ
YRKYPKIISLRAKRMIENAGGRLMGAVLNNINIMRDDYYYYYHYATKKYYGSSKHDKEDDATEA
>gnl|bykdb|A0A3C1HEJ2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=721 residues).
MATPSNYLPGDEGPEASSAVDLPSARTLIEKAWVVVLCLLAAGFITYGYLKRAPVIYASTVTLKVEEQSQKILSGLQEGV
RDDGERPEDLKTIIETLKSRAVIERVIETNHLATDPRVVEPEIQGILSRAKLVARVSDLIAPRLRPATRLIDVTVQHSDP
QLTEQIANSLAREFLQRRFEQQISASESATSFYRQKEQELLETIKTLESLLQEFKKNHPGISEEEQAILSKQIGELNQRI
AASEFNAQSLDRDLSRMTGLGQNVPLLVTMPVVSADPTVSAAMIAVLTQENAMDLVKRDLKPKHPDYIKAQTQLAAAQSQ
LTNAVLKVVGAYATKLSAAKAEEQELKAGLSGLESRRRDLDAAAGEYGIIQNKLKFNRELYERIVKERQVTKVVQTLNKD
PVAIEQRATVPERPIKPNRKQVMLMGALAGLVSGLAVAFGLAATDSSLKSVEQAENFLKVPLLGAIPQMKELQSSDSSQV
IMADPRLVAGAEAFRSLRTTLSMLGPVNERRTFLFTSAVPDEGKTFCTINFAYSLAQQGMRTLLIDCDLRCPTVEEYLLG
RNTESPGVSDYLSGKKDFSDIIQKSQTENFCFIGAGTKSPNPSELLAQPGFKQLLTEALSHFDQVVIDSAPVHPVSDTLL
LAHRAKTVCVVVRANKTPRKAALTAVQKLQKSRANIAGFILNGITLLHRSDYYDYSDYYARYREKDHSPAAPAPKAANSG
K
>gnl|bykdb|A0A3C1UUV7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=732 residues).
MESNNQHSMENQSVAENLNLRHYWHIVLERRWLVIVAFISVFILSILYLFKATPIYEAKTVLQINKESTSMMDGATPIVF
NSNDQEYLQTQYKNLLSRSLIESVVRDLGLDEEGRYAQSQNVINAVRNDITISPVRLSRLVEISVQHPSPRVAAQISNKL
LDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRFREKNKMPSLEESQDTVSKALFAASQSHQLANDEAEQ
AQKAIDEVDKMIREAGESGQLLDLSQIPFVASSEIIKTIRANLVMAKTDLAALQVKYLEKWPAVIEAKERIVKLTEEIQK
VAQDEIDLLREQARYQQARAVRALDSLNARQADMNRLNQLKVEYDNLVMQKMQSEELYTSMLAKTKEMDLSTKDMMQNLV
VVDKAFEPINPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLVERDMQAHL
HPQSNAAEGFRTVRAAISLVHKADKFKVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAFQMQSPI
GISSYLTDQVSDIAEITQKTEVPNLDIICCGAVPNNPSELVGSTRMGELLEAVRGKYDRIFVDCPPVSAVSDPLMIASRS
DGIVFVSKFNKIRRDHARKTIQRIQDAGIYILGTVINDIDFEGKDSYYYSYYYYQNRYYASYYSNEKKLEPNKKSKSVVQ
LDKTAKKSESEV
>gnl|bykdb|A0A3C1VB86 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia subdivision 3 bacterium] (length=738 residues).
MPNPDPLDLPPSLETSAPGSISDLHGVIRLLLDKSWLIVSCLVLALLAAAVYVERAPRVYAATTTVQVEQADAKVVKVEQ
VVSEDMRSQETLNTVAQKLSNLALLTQVLEENHLLPPEGTVVTNGSKTVTRENIISQFEKNVKTSLRRNTRLIDITVRNT
DPGLAARLANSLVKNYLGQDALVQSSVNEEAGVFLRREADRLKKKLEASDQALQDYRKQVGSVSLEQSQDVITPQLQDLN
ERLTQSKASLVQAQGAYQDSLKMSTNTEDLLAYPQIAIEPDMVQISTDLARLENDFAVIRQRYREAHPKYILAASSLAGL
KGQLAANALKARARIQESLRIAYQNVLTAKQGLETQMHEVETNAMKLSDSAVRFNVLTRELRSDQALFDSVIGRLGETSV
AGQITAERIRVIQPALVPELPASPKIKLIFALALFGGLAVGLGISFVLNSMDTSFRTVDEVEHYLALPVLGAIPKLPKTE
GKGNDLAAAQDSNSPNAEVFRTLRATLSMLGRENDRKTYLFTSSLPGEGKTFTSVNYAVSLAQQGLRTLLVDIDLRRPMI
EKFFLGKTSRLPGVTDYFLGRKKFDELCQPHQDVPKLSWMAAGSSVPNPSELLMSADFQKLLSEGLAHYDRIVIDTAPIL
PVSDTLLLAGKVQTVVLVVQACKTSRKAVERSVQLLKNASAPTGGVVLNLLPKRRLSGYYYSYHHGYGYGNYGEKAADKT
SDDTRGNLASEARPENLL
>gnl|bykdb|A0A3C1VJ32 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia subdivision 3 bacterium] (length=728 residues).
MDQVTTSAAPEARLHFLDYWRVIRIRKAIIITVFLITAIIATAVTLILPESYASTARIKVENEGGIVSGMGNSPAATSFG
YDPYFIQTTFEIMQSQLVLSNVIATMNLNVEWGKKYNNGETLKTTETMEILKQRMGLVPVRNTKLISITVYSDDKKEAAD
LANSIAEAYRTYRIQTSQQQATTGLEVYQTQYLEESNRIEMLQANVDNLRRTLDINNGTASSPEPELTVEQLRSYQAQKL
ESEQAYNVSLVQLQDLQTIQQTNQSKLRDVLPGVVSDAELGSLLAQYHEAQRKIAALKVDYSPANLDVTRVQTLIDTLDG
QIIDRVAGIMVTLQSQVNSKKASLDSLVQQVEEAKQKDHDNATKNQPYYDEKRKLDQLLDSHKLLYTKIVIDTIDAQIPK
TTMVEVIDRAEPGKAPVKPNKTLNITLGLIFGLIMGVGLAFFIEYLDTSVKTIDDVERTFQAPVLGVIPQNIGYLLEEGA
ESKHAEAYRVLRTNLLFSRKDEKLNTIVIVSAGAGEGKSTTTINLSTVFAQAGNRVLIVDSDLRRPTLHKLFKVANNLGL
TNYLLKQNTVVEVVQTTSVPNLDFMASGKLPSSSMGILGSAQMKELIAELKQRYDFIFFDSPPILGVSDASILASEVDLV
MQVIQYRRYPQPMTIRAKQMIEKVGGNFVGMVLNNINMSQDEGYYYYSGYYHDYYYSRDPSEQEAEAKKADLAAKGPGDT
EVNIKQKY
>gnl|bykdb|A0A3C1W2R2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=732 residues).
MRNGPERQTNASEAALHAVDYWQVLKNRYGVILLTFLLIFMTAAVITYVLPKKYESTALLQVNHSFIELDPLNGSVGQPM
TGASPSHAYIQNQFKIIESEKTLLRVVEQLDLPTRWNGFDRNMAVLKLKSILKTEQIRNTDHIEIRIRHQNRDDARDIAK
AIAKSYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYIEGVLTSGRMGQSEETILRTAEMQQF
TAEEKKGQLENQIAQLLTLRDEELIDFAEGLQLPGSQVPVLRARYQEGKVNIAALEASGLGRKHPSVEMAYIAQEKLSED
LKSSVVVLRELLKTQLNLVNGQLDKIKDRVEDRRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKT
PITILEEAKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIPTDVGVLHKQSGMS
PDAEAYRILRTNIEFNRNNPEDNSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFFDINNSVGLSN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMI
VVQHRKLPRNMLVRVKEAVENVGGHVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSADSDPVPSVGATASGTSAATESTVA
ANDEDKDEGLTY
>gnl|bykdb|A0A3D0YP62 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=715 residues).
MQPQNSQQNEASLHAIDYWQVLKNRYGVILLTFLLVFLTAAVITYVMPKKYESAALVEVKPISDIDPVGMRGGGIGTPMT
RQFMNTQFEIIVAPETLGRAIDKIQLETSWGQDRKTVIDVLRQIVRTTQRRGTDLIEISVRHRKKEEAQRIAEAVYEAYK
DRRYDLEINVRKDQLKAVKVELQNKSDRVAELRKRLMDIAEKVGVIWVESERGGETIGGELELRQLAERQLYEAERERDQ
LKFQIDKLLAVADEDLPGLAADLPDVGFREAYNKFEDAKAELQTAKASGLGNKHPDIVMRTTRIEELKKGLEKRAVNVRQ
SLTHKLGIIEGRVNKMREVRDKKQDEGTDRARAFQEFNIARKDYETAQGIKDQMQIKYDIEKTKLAIPPTNIIIHQIPEI
NDIAVSPNIPLNLALGAVVGVIFGLGIAFCLEYLDTSVKSLEDVERFLQVPVLAVIPKDVGVLHRQSGMSPDAEAYRILR
TNIEFNRKNPEDNSITVVSGGAGEGKSTTLCNLAYICAQGGYTTLMIDADLRRPRLHTFFDINNSVGLTNYLTTDLLLED
VILQTPVDNLYFMPSGILPADAAGILNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTIVVVQHRKLPRN
MLVRVKQAVENVGGHVIGVVLNNVDVRSDNQYQYYTSYYTYYAPTTGDEIARDTATAAPAPSQQAQPARNDEDLY
>gnl|bykdb|A0A3D1TI55 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=703 residues).
MDEKQQDSSLHFLDYWRVIRARKEIIITVSVLIILTVFIITLIMPEKYRASVRITIDQYRPDIELVDRGRQSQYDPYFYL
TQFELIRSRPVLTGVIRDMNLQEVWGRQFNDNQEEMDLESTISRLRSMVETVQVRGTTIIEVQVTSRDSAEAAAIANKIA
EVFQETRLASVKKKYSDALVQMQEEMDQQKFKVRELEDNVEDLRLQNQIVFGATGAELSKERLDQLQLELERARLDLWTA
EAQLQKVESLEGKQLEDAIPFLVNDPSYNTLNQQLVEAEIAYRAAEENYGPKHPEMVKFQTTIDELRRAKEQKLVAIKEG
LASRYDVAQRRVENLEQEMDLLRNQDLERHREAFLPFERALRDRDAAKQVLTALEHRVAQEVIELEIPSTPVEVVETAVE
PRSPFSPSWTLNILASIFGGLFLGVALAYFIEYMDTSVKTIDDVERFLGLPVLGIIPQRVRPLVEEGPDSPHAEAYRVLR
TNLQFAAKDPGANAITIVSGGVGEGKSTTLFNLAYVCAQLGDKVLLVDSDLRRPALHKILGMSNDFGLTNVLMRDVPIEE
TIKSTSVPNLHFLPSGKLPRTSVGILNSQRMRELIKTLKSRYDYIFFDSPPIVGVSDASVLASEVDLALLVVQYRKYPKV
MSNRAKKMVENVGGRLVGVVLNNINVMRDDYYYYYHTYYSHYYGPQEERTPDRPKELDVGEAY
>gnl|bykdb|A0A3D3DIJ3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia subdivision 3 bacterium] (length=724 residues).
MDPLKVAPPQEAKLHFLDYWRIIRIRKTVILAVFLLVVITATLVTFILPESYSSKARIKIDRDQTDISGLADRSTLAGYD
PFFIQTEFELIQSELILGKVVADLDLNTEWGRKYASGERLRTPETIALLKQRIDLRTVRGTSLIEIVVYSEKPEEAARIA
NAIADAYKTHRQEQRAQLSRGGIKALEERFAEQEAKVKAAQERVDNLRKELNISDAMASGDGPSPLMTAETLRKIESLRI
ESQAEYVRQATRLDRLKNLGKELGPEGLAQAITTDAPDTLLTSLLDQLTMAEQRLIALEADYGPENTEVLKCKGLAEDLH
KKIKSRVEGIMLGLDTRVISLSNSLVNLQQEVGRATTNDVTQANLTRPYFEAKRALEELQRFRQVLDAKIAFEKIDVELP
KTLMVEVVDRAMPGLRPVRPNKPLNIALGIIIGLVVGVGLAFFIEYLDTSVKTIDDVERALQCPVLGVIPQNVGLLVDEG
TESPHAEAYRVLRTNLLFSRKDDKLNTIAIVSAGAGEGKSTTVFNLAAVFAQSGQRTIIVDSDLRRPTLHKMLRVTNAIG
LTNYLLRQNTLEEVIQTTSLPTLDFLSSGKLPSSSLGILSSTQMKDLIGELKQRYDFVFFDSPPIMGVSDASILASEVDM
TIQVIQYRRYPQPMNIRAKQLIEKVGGNLVGIVLNNINMSQDESYYYYSGYYHDYYYRSEEQEPVVKEGAESGGKDKLDI
KQKY
>gnl|bykdb|A0A3D3DV47 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=715 residues).
MQPQNSQQNEASLHAIDYWQVLKNRYGVILLTFLLVFLTAAVITYVMPKKYESAALVEVKPISDIDPVGMRGGGIGTPMT
RQFMNTQFEIIVAPETLGRAIDKIQLETSWGQDRKTVIDVLRQIVRTTQRRGTDLIEISVRHRKKEEAQRIAEAVYEAYK
DRRYDLEINVRKDQLKAVKVELQNKSDRVAELRKRLMDIAEKVGVIWVESERGGETIGGELELRQLAERQLYEAERERDQ
LKFQIDKLLAVADEDLPGLAADLPDVGFREAYNKFEDAKAELQTAKASGLGNKHPDIVMRTTRIEELKKGLEKRAVNVRQ
SLTHQLGIIEGRVNKMREVRDKKQDEGTDRARAFQEFNIARKDYETAQGIKDQMQIKYDIEKTKLAIPPTNIIIHQIPEI
NDIAVSPNIPLNLALGAVVGVIFGLGIAFCLEYLDTSVKSLEDVERFLQVPVLAVIPKDVGVLHRQSGMSPDAEAYRILR
TNIEFNRKNPEDNSITVVSGGAGEGKSTTLCNLAYICAQGGYTTLMIDADLRRPRLHTFFDINNSVGLTNYLTTDLLLED
VILQTPVDNLYFMPSGILPADAAGILNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTIVVVQHRKLPRN
MLVRVKQAVENVGGHVIGVVLNNVDVRSDNQYQYYTSYYTYYAPTTGDEIARDTATAAPAPSQQAQPARNDEDLY
>gnl|bykdb|A0A3D3XF90 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=732 residues).
MESNNQHSMENQSVAENLNLRHYWHIVLERRWLVIVAFISVFILSILYLFKATPIYEAKTVLQINKESTSMMDGATPIVF
NSNDQEYLQTQYKNLLSRSLIESVVRDLGLDEEGRYAQSLDVINAVRNDITISPVRLSRLVEISVQHPSPRVAAQISNKL
LDNFLARNLDQKRERAFQSYQWLDTEVDGLQEEVKNSRLAVFRFREKNKMPSLEESQDTVSKALFAASQSHQLANDEAEQ
AQKAIDEVDKMIREAGESGQLLDLSQIPFVASSEIIKTIRANLVMAKTDLAALQVKYLEKWPAVIEAKERIVKLTEEIQK
VAQDEIDLLREQARYQQARAVRALDSLNARQADMNRLNQLKVEYDNLVMQKMQSEELYTSMLAKTKEMDLSTKDMMQNLV
VVDKAFEPINPVKPRKSLTLALGVIGGLGLGFALAFFANYMDDSIKSQDDIETHLRLNFLGYIPNIKTNSLVERDMQAHL
HPQSNAAEGFRTVRAAISLVHKADKFKVLAFTSTIPSEGKSLVTSNLAIVTAQTGVKTLLIDADLRRPSMHKAFQMQSPI
GISSYLTDQVSDIAEITQKTEVPNLDIICCGAVPNNPSELVGSTRMGELLEAVRGKYDRIFVDCPPVSAVSDPLMIASRS
DGIVFVSKFNKIRRDHARKTIQRIQDAGIYILGTVINDIDFEGKDSYYYSYYYYQNRYYASYYSNEKKLEPNKKSKSVVQ
LDKTAKKSESEV
>gnl|bykdb|A0A3D3XGB5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=730 residues).
MQTKPSQQPQQQSDSKLHFLDYWRIIRIRKTVILAVFLLVVLTTAIITFLIQPTYASSVRIAIEKDNSDITPLMGLQAAQ
QHDPYWVLTEYEKIQSKKVIHPVINALGLNHKWMERFKTDTPLTTNETFQVLKNSIDVDQYRNTSLIEIKAYSKDKEEAA
LIAQEIAEQYKKVREKNLKDMANSGIEVLKQEYLTQQNKVQTKQKDLDKLREDLNISDIYSAEGSSIGMTTEPQIVMKLE
QERTVAEANLIRYETLFKELTSLTLEELRNTLLTAMPGNLRLTSLLNEFDRGHQQLSQMKAIHGPDHPQMQASNSLLLTL
NDQIKKEITGVLRGLQTQVNAARNQLTELTSAVESAKASDAEKTAEYRPYFTAKRDLENLSKISDMIMIRILQETVDAAL
PTDSIVEIYDPAEPNPDPVRPKIFLNIALGVVVGLVVGIGLAFFIEYLDTSVKTIDDVEQALDAPVLGVIPQNVHSLLME
GPDSPHAEAYRVLRTNILFSRKNEKANTLTVVSGGAGEGKSTTIFNLATVFAQNGSRILIVDSDLRRPSLHKHVGVSNAL
GLTDYLLATKSLEEVVQTTKHENLDFLPSGKLPSSSMGILNSSKMKSFIAEARKRYDYVFFDSPPIMGVSDASILASEVD
MAILVIQYRKYPQAMTVRAKQMVEKVGGNLLGVVLNNINISQDSYYYYYSGYYYDYYSKQDGDNTSSKKKSDGKSGKTSA
RGDLELKNKF
>gnl|bykdb|A0A3D4CU34 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=732 residues).
MRNGPESQTNASEAALHAVDYWQVLKNRYGVIILTFLLIFMTAAVITYVLPKKYESTALLQVNYSYIELDPLNGSVGQPM
TGASPSHAYIQNQFKIIESEKTLSRVVETLDLTTRWSGFDEDMALIKLKSILKTEQIRNTDHIEIRIRHQNREDAQAVAK
AIAESYKDGRNKEELKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYIEGVLTSGRMGQSEETILKTAEMQQF
TAEEKKGQLENQIEQLLTLRDEELIDFAEGLQLPGSQVPVLRSRFQESKVNIAALQASGLGRKHPSVEMALIAQEKLQED
LKASVVVLRELLKTQLDLVNGQLVKIKDRVEDRRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKT
PITLLENPKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFFLEYLDTSVKTLEDVERYLQVPVLAVIPTDVGVLHKQSGMS
PDAEAYRILRTNIEFNRSNPEDNSITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPTVHTFFDINNSVGLSN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEADLTMI
VVQHRKLPRNMLLRVKQAVENVGGYVVGVVLNNVDVRSDSQYQYYTSYYTYYAPSADADPVPGGGVTKSAERASVKTPGG
KNETDDEEGLTY
>gnl|bykdb|A0A3D4HF88 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutae bacterium] (length=759 residues).
MRNTTESMVQDPQEEASKRKPNYHNYHSYHNHGYHGYHGYGGHGGAGYGGYGYGYGDDYSTQHRQPPRTFRDYIFILRER
IWFFLVIFLIVFLGSVLYTFNTTPLFTAGATVQVLRDPVNPLGAGAEDITKEEIRTSEDLNTQIKILESLAIVNSVADRI
KGAERKMLMEPYKGDEEVTINEVLYENRDVVPLRASLLIAVTYTHPDARIAAHVANLFADEYINYNLRLTIENSMKAVED
LKLRVNQQRSEVEALETRLAEYKERTGSISVEEREDIDLQEIMQLNQVLTTTKQVRDQSKHRWEQIQSFKAEGKPLQDLP
FIAEMPLVQDLQSQLSELKVSQSSAAKRYREGHPRMISINQSIDETQSELTAAVNSAVQKVHAAYVISDTNYNHAKAEIS
RKEKDLIGLAKTKVEFNAIKTDLEANRDLHRAMVLRLNTEIAQVNLKNPTARIVDKATPPIYPSHPKILLNLFLGFSGGI
MLSLIFVGLLAFFDDRVKTAYDVEGILNLPLIGVVAKLQELSAKEKAIAVASNADRRVTEAFRSVHSALNLNEISKNAQI
ILMTSTVPSEGKSFVSTNLAYTYASHGERVVLIDCDLRMPNVAKSMNLSNEKGLQQCLKDGSRPEDVVHKDVYPNLDVMG
SGGHSQKSTQILNDKRFIALLEDLRGSYDRVFIDSPPVAAVSDALNVLPHVDGVLYVINYNTVKRKTVKASVRRLFESNV
PVFGVIMNQITAAMSSYYYTNYYEKSYDKYYTGGSNPKA
>gnl|bykdb|A0A3D5JZU0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiales bacterium] (length=728 residues).
MEPTSGKENSSDKLHILDYWRIIRVRIVTILLVFLLTAITTTVVTFLIPKTYMSLSRIAVEKDTSDIAPLLGMQATQSSF
DPYFISTEFEKIQSQKVLDEVVKSCELREKWKKHYGGKQLTDVEARKHLEKVIDVSQYRNTSIIELRAYDRDKNLAQQIA
QALAKEYENYRSSLQEERVKAGIDKLRERMEKTNDEITAMQANVDDLRAKLGISDAAGEDSYSIVEPEIVRRYESELITA
KGLYTQQATLLQGLQEQSLEELRESIMTANPDAQLDALIREYQTGQTTLANKSIDLGEGHPTIKSLKAAMESLNQQIDNR
IKGILAGLELRVNSSLAQVRELQKSVDDAKAKEAKVQEEGREYFDAKRKLSNTTRMRDTILFRIMQEEVDLDLPKTSSVE
IIDKADTPLRAVRPNVPLNISLGVIVGLILGVGLAFFIEYLDTSVKTIDDVERALNAAVLGVIPQNVGSLMDEGDESPHA
EAYRVLRTNILFAGRKSEDQTTFSVVSGGAGEGKTTTMFNLAVVFAQMGDRILVVDSDLRRPSMHRYFKVSNTIGLTNLL
LGQNTLDEVIQTSESTNLHFIPSGKLPSSSMGVLNSAKMKQFVAEMKSRYDYVFFDAPPIMGVSDASVLASAVDLCVLVV
QYRKYPQLMTQRAKDMVIKVGGDLVGVVLNNINISQDSYYYYYSGYYYDYYYKSRETEEEPVEDKKDGKEEKLIAQADAV
GEDVKPKY
>gnl|bykdb|A0A3E1E2T2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=713 residues).
MAQPSASKDSATLADFLRLLRLRKSLILLILSLVVITTVAVTAFLPRWYLATAKIRVEKPESEVKLFQAQSSSSYDPYFL
QDQFKILQSEKILYPVIKNLKLSTVLAPALDSPEPLPDAITYHYLLQKMLRVESQRSSSLIEISVYSEDPTLGAVIANEI
ARVYSDDRINLATSDQREGFVKLRGELIAQEQVVMLQRDTVERIRKDLNISGVDLNARYSDMEIETLRQMQNSLIALSVD
AIGRKTRWERFKDIPFEERVSLVNSELIPDINIQNLLQAYLLADQNVTKLKARLGEAHPDLISAIDNRAKIKEQLDAQLR
GYENALEIAYKEAEARVTELKRQLSQAKVDQILSARDRMRPFEEAAQKLEDETKLLTTLKLTLRQREIDFQVPKRTIEIL
NTAEPARRPSRPSWPLNSAFAVLFGSILGVGAAVLLEYFDTSFRNVADVETRLKLPVLGVIPFHRDPLDEEGDPAETEPF
RVLHTNLNLALKPGEAASLVLFSAGPGEGKSTTLHRLVRVMAAGGERVILIDSDVRRPTQHHLADRPREPGLSEFLLNRK
TLDEVIQKGLAPNLDFIPSGHAPGFTLGLLHLNRLKDLIATLSGRYDKIVFDSPPIIGVSDASVLASAVDGTVLLIQHRR
NPQSMVVRAQQIVESLKAPLLGVVLNQVPLNSGDDYGYYTNNYSYYSEGSGRRRRSAAKPKSPGRGGDELKLS
>gnl|bykdb|A0A3E1EJT7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=725 residues).
MNPPSPYARSSYAPVNPDFTDGEEPEDNDYLRRWWVMVLERKWYALAAFVVIVAGVSAYTFLSTPIYAGQVTVQVLKHGS
QVMRVADVVDSNITSEPDFNTQIKVLESLTILQNVANRLTPDELRLLLEPYKSHAGEPPSPASIIYHNRQIIPQRLSLMT
AIEFRHPNPKIAARVANLIAVEYIAYNSRLRVEESLKAVDDLKDRADQQRKRVDEIANSLLAFRQRGNLISLVQSKDIVT
EKLKALNMMGTQTNAHLKEAEVKWNQVQEWTKAGRSLSELPFITSQAKVGQLLVQVTTQKLSVTQLRDRYKDKHPRLIEA
VNALNQTEQELQASLATAAESIKAEYENAVQTDEGARKALADQETKSLEIDKYAVEYDNLNRDFRVNEQLLESMMSRMRE
TSVTSSIETESARIIDRAYEPGNPVSPKVFFNLTLGVLAGLVAGFSVAFLIATLDDRIKTISAVETLVDLPLLGVIPEVK
RMDQPDKAQIVSNGSDPAIVEAFLSLYSNLRINDESRNARLILVTSTLPSEGKSFITTNLGLTFASQGQRTVIVDCDLRK
PNVERSFRLQTTAGVISYCLQGSALDDIIVKNVHPYLDIISTGGRAKNPIQLFNSKEFETLVVELSKRYDRVLFDTPPLG
AVSDALNILPLMDGAIYTIHFNRVRRKAAQQCTRRLLAVNVPVFGAVMNGMNTGITGDYYMENNSKLFKEYYNPGGEPPV
TSQSS
>gnl|bykdb|A0A3E1ET42 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=722 residues).
MREQLNESKMHALDYWQVIRNRWGVILLTFFLIALASLVIIALLDKKYQSTTRFRVLLSSAIDPFQTNEISNRSAYSGNW
LETEFKTVTAHETLSLVIKKLNLDQTWGLTFDEALTKLERMIETETERGTEIMTVIVSSVRRDEAAAIANEVREAYDAQR
QEIEAERIRRLTQTLDAKIKSSENDLEAARIVMNEVARKHGIVDNSYQGGQGFTAVVTTKPEEYADSLRSQGVLEQQVIR
LRSQLESLMKLEGDQLIANAASLDVQNDTIKALYPEYQKSVIEESRLLNSGFGKNHPKIRGLRESINTTRKTLETAVSGF
KDSLKVQISQAEQTLAKGQELTDTKKLSTVEDRAKQSEYATEKTKFEMQRQLLQQVKEHSMKTAVDKEVPRKPIEVLQVA
TPEPRPSKPNMMLLFSIGAGLGLVLGLLLAFFLEYLDTSVKSLDDVERYLGVPVLAVIPKDVGILHKQSGLSPDAEAYRI
LRTNIEFNRRSADANAITIVSGGAGEGKSTTLVNLAYICAQGGYNTLMIDGDLRRPKLHTFFDINNSVGLTNYLTTALML
EDVILQTPIENLYFMPSGILPADAAGILNSRRMSELIADVKNRFDLVLIDSPPILGVSDASVLASEVDLTIIVIQHRKLP
RSMLLRVKQAIENVGGNLLGVVLNNVDVRSDSQYQYYTSYYTYYSPTNAEARKPRQAAPAGGAPQRPAPAKAGAGRGENE
DY
>gnl|bykdb|A0A3M1I883 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=761 residues).
MQSTSSSARPQTEFHFLDYWRIIRIRKMVILAVWLLVVLTTLAVTFVLKPTYASTVRIEIEKDATDIPTIGGQQRDPSFD
PYFMATEFEKIQSMSVLMPVIHSPTNAAGEKLPPDRQFIPAWSKRLGLRDGELLNEQEAYQYLLRNMEVKQSRNTKLVEI
TVYSPIPEEAADLANLIAASYKNWRQHSRREHMTNAIAVLQQKLEEQNARVERLQKQLDQLRLELNIPDTVAGTAGAYSI
STERERLSTLLQALQQARSDLVYWKSKLQELERIRDKGLQDLRDAILTVMPSEALLPKRIDDLDVVEQNLSKLLKDYTPE
NPEVQRYMALKDTLQKQITNRLNGILEGMRAQVASFKARYDEISNQVAQAERAVAEEAARFSQYFDLKRQWENEQRIRDT
LLLRTLQETIDSALPTESVVEVTDPAVPALKPVRPDLFLNLVLGVVFGLVMGVGLAFFIEYLDTSVKTIDDVERSLEATV
VGVIPQNIGLLIKEGPDSPHAEAYRVLRTNVLFSRKNPNDNTITVVSGGAGEGKSTTIMNLATVFAQNGERVLLVDSDLR
RPSLHKFIGVSNSIGLTNYLMKQNTLEEVIQTTSLPTLDFLPSGKLPSSALGIINSPRMKELVDEVRNRYDFVFFDSPPI
MGVSDASILCSMVDIALLVVQYRKYPQAMTLRAKQMVQKVGNNLLGIVLNNINISQDSYYYYYSGYYYDYYYGSSSEYGR
RRRKSSRKRRKSREKDSSAEAPATAATETEEAETPELKEKF
>gnl|bykdb|A0A3M1I8A3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobia bacterium] (length=719 residues).
MAYQAYPQTAPADPVSLPPAGGAMGSMTLRHYWHVLLERRWLVIMVLILSVAASVGYVVKAPRIFRATVRLQIDPESETG
VNLRDGFGGVSRMDPEYLQTQYKNLLSRSLLERVVKAERLEQDPRYSKEMDIVAALAKDITVTPIRMTRLVEVSVEHTDP
RKAKDIVDRLANEFIERNRLLKTGRMMSTLQVLRSQAQQMEREVTELEEAVQQYREKQNFVSFDAGSNPVAQSLSQVQAR
YADAKATAEIMQATIRELDAHLKAGRPAETFPSVANDSRVIELQKRLTGYRTDLGAMLQRYGEKHPAVVTLRSQIAETEK
ELQQTVKDVIETLRKSAELRQIELANLEENLRYWEQKQQEWNKAKTTYDVLQRKADASRALFNMVLSRLSEAEVMQRDTA
NNINIVDPATIPTEFVKPNIPVVLTAGVLGGILLGIGLALFVNYLDDSIKSQDDVELHLQMPFLGYVPSIKSAKEVERYL
QCHLHPQSNASESIRSIRAAVALGDHGEKLRVLTVTSTIPSEGKSIIAANLAIAMAQTGYRTLLVDADMRRPRLHKAFQL
HNPVGLPAYLHGKTDQFEELVTATEVPNLDMISCAGGSSQSTELVASRRMVQFLDEARKRYDRVILDTPPVSAVSDPLVV
ASLSDGCVFVAKFNKVRREHARKTLRRLLDAGVHICGVLLNDIDFEGRDSYYYSYYFYQNRYYSSYRSRPDQIGAVRST
>gnl|bykdb|A0A3N5WCF1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Verrucomicrobiaceae bacterium] (length=722 residues).
MNTSAPQQNEAALHAVDYWQVIKNRYGIILLTLLLVFMTAAVITYVMPKKYESQAVIEVKPRMPGMSPLGAAMTETSGGG
RMSPQFFGTEFEKIKSRNSLAKVVDNLQLVNRWNVDKEAALGILKGIVGTQNIRGTDLISIRVRHTNKVDARDIAEEVAR
AYKEYRAEIETRDADRQLQELNKAVRDQEDKVEERRKVLATIVRNKGIIYRGQDAFYESGGVDEDQGARNALQIYHDIEQ
EKLQLESQISSLLKYDSDQLMVYAGGLNLPDNIIRTLYPQYQEAKRQLDGLKISGLGDRHPTILVAVDQIENMKRQLDEG
VVNLRATLQAQLDLAVNRLKSVEVMKDESRDEAIKRGLDAQDYVDAKREFETDQQLLETMKLKQMGETISRKIPGESVEV
HDPPVISNSPVSPNVTLNLVLGAVVGLIFGVGIAFFLEYLDTSVKTLEDVERYLQVPVLAVIPKDVGILHKQSGMSPDAE
AYRILRTNIEFNRKNPEDNAITVVSGGAGEGKSTTLVNLAYICAQGGYTTLMIDADLRRPRLHTFFDINNSVGLTNYLTT
ELMLEDVILQTPVDNLYFMPSGILPADAAGILNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMLVVQH
RKLPRNMLLRVKQAVENVGGHVIGVVLNNVDVRSDSQYQYYTSYYTYYAPAEAQVVAPPPGSSSAPSKPQAAATRGADSE
LY
>gnl|bykdb|A0A3R5R2M8 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=803 residues).
MNAAPNTTSPMEEEESSFSLDTVLVILRRFWFLIILAAIAGGSLAFYLAGRQNYVYQKTASVMMRDAKSGTDASSERIMS
ELGIDSGAANLANESFVLKSTAIMQKVVEDLKLNTSYWQAQDFREIDLYRNSPILAVFEEIGSNRSCRISVTPVGEQSFI
LAYSNSREEPAFLKGEYGQPISLPFATVSIHPTSVMNADWNGQTVIIRHVPSQDTARALLANFSVARPDAKDSSLLEMTL
TASNPQKAEDVLNHLIEVYNQISIDEKKQSALKTRKFIEGRLAELEKSLNKADKELTDFKAKSDIVKDTETTMSADFSSS
QVLEKEIFELETQIKLSSVLADNLKEAGRNGGLISVDTGLTDNGLSRQIENYNEAWLEYRKIAGSAGSRNPIAAGLRDRM
ESTRAAANKALANYRNNLDIKLKELNAKRDSLAERMARTATREQELTPLVREHKVKEELYLILLSKEQENAMALAATEAS
ARVLESAHGPDIPIAPQTVQYLAAGILGGGALCFFALLGIAMLNNKVKNKYDLPAQVRQPVIAELPKMSKKERKNNTPLI
RNDHSVIAECFHILRNNVDSLLPRPDAGGYVILLTSTCPAEGKTFASANLAAAFAKAGRKVLLIDGDLRKRSLSRQLGGY
GRRGLTSILLNRLQTAALPIRRIEETGISFDFLGAGPAVPNPVSLLSQPILGQMLEHLKKQYDTVIIDAPPYGILADTAI
LASWSDISLYLTRSGMIDKRYFPQVQKLADTGKLPNLAFIINGVNFKSASYNYYGYGYGYGYGTGSRSRRNEPETAPEDS
DKQ
>gnl|bykdb|A0A3R5SIG7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=798 residues).
MANNTAPTPPVTENTEETTSLDTVLLVLRRYWFIIILAALAGGTAAYYLAGRQNYIYQKTASVLMRDAKTSSDASSERIM
AELGIDSGAANLANESFILKSTALMKKVVEDLNLNTSYWQKKDFREIDLYKTSPLLVHFERIDKQRACTLHITPLDEKRF
MLSHYNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMTDTWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESSLLEMS
LTASNPQKAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEFKTKSDIVKDTDTTMSADFST
SQALEKEIFDLETQIKLAAILADNLKETERKQGLISVETGLPDSGIARQIEHYNEAYLEYQKIAGSAGSQNPITVSLRDR
MNSTRAAANKALSNYRSNLNLKLNQLISKRDSLTERLTETASREQEIIPLIREHKVKEELYLMLLSKEQENALAMAVTES
SARVLETAHGPNFPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESRNTGLF
IQDEHSVIAECFHILRNNVDSMLPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLGG
SGRKGLTSILLQQSSDTTGIIRPLRENSRGMDILYTGPMVPNPVTLLSHPLLGQILGILKKQYDAVIIDAPPYGILADTA
ILASLSDITLYAVRSGKIDKRYLLQIQQLADQGKLPNMAYIINGVNFKSSSYSYYGYGYGYQYGYGSGEPRQTTRKQD
>gnl|bykdb|A0A3R5VEW0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=735 residues).
MSVQDQQNSDRIVRNIDYLQVLKNRWKEVFLVFLLVLVISVVVTFLMPPSYRATSQFQIKLPKPVMDIGRGGDVVATSNV
TANYIPMQYSVLTSAEVLKVVSRKLNLAAEWGMTDEMAATNLADMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAY
KQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTSWRNGEHRSTLTAGMEEEEFRNAKAQAMDFE
RREKELASYVQELQRLPDDKLLDYVISSDLLNAETVGADALRKTYAEFSDKLKEKENLKSQNIGARHPKMLALLETERIL
GDKLNKELIGLRSSLKSKLEMVAASRKHWEATVAQKEEDLQKHVLQVPMYEQASRDYDAALDQLKELDSRYKDEIARLRV
PREAIEMYQLPTYPAAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSD
VMGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNEVG
LTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDM
TLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSADGASSGENADASSMKKVERSGKA
KELAATQSHDSEDLY
>gnl|bykdb|A0A3R7RBB5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Roseibacillus sp. TMED18] (length=732 residues).
MRNGPERQTNASEAALHAVDYWQVLKNRYGVILLTFLLIFMTAAVITYVLPKKYESTALLQVNHSFIELDPLNGSVGQPM
TGASPSHAYIQNQFKIXESERTMGRVVERLDLTTRWNNFDRNMALLKLKSILKTEQVRNTDHIEIRIRHQNRDDARDIAK
AIADSYQEGRNEDERKRAGDALDALESEVRSQEDLVEDKRRHFHSIVRAVGIPYIEGVLTSGRMGQSEETILRTAEMQQF
TAEEKKGQLENQIAQLLTLRDDELVDFAEGLQLPGSQVPVLRARYQESKVNIAALEASGLGRKHPSVEMAYISQEKLSED
LKSSVVVLRELLKTQLNLVDGQLEKIKDRVEDRRFDAVDKALQSQDYVEAKQDYETAKAMLSQMKLTNSARRIALKIPKT
PITILEEAKIGMDPVYPKVTLFLSLGAAVGLIFGIAIAFSLEYLDTSVKTLEDVERYLQVPVLAVIPTDVGVLHKQSGMS
PDAEAYRILRTNIEFNRNNPEDNSITIISGGAGEGKSTTLVNLAYVCAQGGYTTLMIDADLRRPNVHTFFDINNSVGLSN
YLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGLLNSRRMSELIQDVKQRFDLVLVDSPPILGVSDASVLASEVDLTMI
VVQHRKLPRNMLVRVKEAVENVGGHVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSADSDPVPTVGTTASGTSAAIESAVA
ANDADKDEGLTY
>gnl|bykdb|A0A3R8IT45 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium TAV4] (length=750 residues).
MDPSQSAQTQPNDGRYGYGYQEYPGYGNENAAGHRTLGDYLLILRERIWYIVVVFLVIFSSALVYTFSQTKIYRAMATAQ
ILRKTATMFSQSREMLDSTMFSTEDINTMVKVFESSIIIQKVSERITGEELKKFMEPYEKGRFGDPLTPLEVLGQNRKIV
PLRLSLIVGVEYTHPDRLIATKVANLFLEEFITFTSRQRIDQTFTILEDLKLRAETQKKKVEELQFQMQAYREKYGLTLD
PKKDILTKKLVEQGSVLTQTQSRLGEAEVRKNQVEARIKAGGDLTELPFIAANHLVAQLSQLVSMRKIEVKQLRDRYKDK
HPKMIEANNALAQAELELKRAVDSAAASVISEYETAKNADTEARAILEQIKTESLSTDKEGVAYQMLERDFMMNEQLFLK
TVERIKETELTNTIEAQNVQVMPLARAVQPREDEYVEPRIVLNLAAGFVLGIGFGLAFAFVVAFIDDRVKSSFDIESVVG
LPLLGVIPQIKKMDQADKAQVVSNNADRQVSEAFLTLHSSLRLRNDSKNAQTFLTTSTVPGEGKSFTTTNLALTFAAHGD
KVVIVDCDLRKPNIHKSFRRENLKGVIDVCAGSATIDDVVMRDVAPNLDVIATGGRAKSPTQILNSKNFEIMIAELRKRY
DRIFIDTPPLAAVSDALIILPLANGAIFTIFFNKVRRKAAQHAARKLLESNVPVFGAVLNGLNLAVAGYYYAQYYDKSYK
DYYVMAGAEDAIDNSASNEEEDVVAPGSKS
>gnl|bykdb|A0A410SCC4 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=735 residues).
MNAQDQQNSDRIVRNIDYLQVLKNRWKEVFLVFLLVLVISVVVTFLMPPSYRATSQFQIKLPKPVMDIGRGGDVVATSNV
TANYIPMQYSVLTSAEVLKVVSRKLNLAAEWGMTDEMAATNLADMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAY
KQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTSWRNGEHRSTLTAGMEEEEFRNAKAQAMDFE
RREKELASYVQELQRLPDDKLLDYVISSDLLNAETVGADALRKTYAEFSDKLKEKENLKSQNIGARHPKMLALLETERIL
GDKLNKELIGLRSSLKSKLEMVAASRKHWEATVAQKEEDLQKHVLQVPMYEQASRDYDAALDQLKELDSRYKDEIARLRV
PREAIEMYQLPTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSD
AMGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKSTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNEVG
LTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDM
TLMVVQPRKLPLKALLRQKQVIESVGGNLVGVVMNNVDITSDHQYQYYTTYYSYYSADGSSSGENADASSMKKVERSGKA
KELAATQSHDSEDLY
>gnl|bykdb|A0A411SSG2 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=735 residues).
MSAQDQQNSDRIVRNIDYLQVLKNRWKEVFLVFLLVLVISVVVTFLMPPSYRATSQFQIKLPKPVMDIGRGGDVVATSNV
TANYIPMQYSVLTSAEVLKVVSRKLNLAAEWGMTDEMAATNLAGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAY
KQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTSWRNGEHRSTLTAGMEEEEFRNAKAQAMDFE
RREKELASYVQELQRLPDDKLLDYVISSDLLNAETVGADALRKTYAEFSDKLKEKENLKSQNIGARHPKMLALLETERIL
GDKLNKELIGLRSSLKSKLEMVAASRKHWEATVAQKEEDLQKHVLQVPMYEQASRDYDAALDQLKELDSRYKDEIARLRV
PREAIEMYQLPTYPAAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSD
VMGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNEAG
LTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDM
TLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSADGASSGENADASSMKKVERSGKA
KELAATQSHDSEDLY
>gnl|bykdb|A0A411SUQ6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=868 residues).
MPLNGTAGVSPGLALLWPWSPCACNGHSAAFSSGLIIPVNGNIGTVRLYRTDSPGVQYFHTTFHPLSSMTNNTAPTPPVT
ENTEETALSLDTVLTILRRYWFIIILAALAGGTAAYYLAGKQNYIYQKTASVLMRDAKTGSDASSERIMAELNIDPNAAN
LANESLVLKSTALMNKVVEDLNLNTSYWQKKDFRELDLYHATPLLVHFEQIDKQRACTLHITPLDEKRFTLGHPNDQGEL
ILLEGFYGKPLTLPFATISVHPTSLMTDAWNGKTVIVRHSPVLETANALLRGLTITRPDSKESSLLEMTLTSSNPQKAED
TLNHLIQVYNQISKDERNKASLKTKIFIRDRLKELGASLSDVDKKLTEFKTKSDIVKDADTTMSADFSTSQALEKEIFDL
ETQIKLASTLADNLKESERKHGLISVETGLPDSGIARQIEHYNEAYLEYQKIAGSAGSQNPIAVSLRDRMNSTRAAANKA
LSNYRSNLDLKLNQLINKRNSLTERLTETAIKEQEIIPLIREHKVKEELYLMLLSKEQENALAMAVTESNARVLETAHGS
NLPISPKTIKYVAGGTAGGALLSILAFMGAAMLNNKVNNKHDLPAANRQPVIAELPQMSKKESKNTKLFIQDEHSVIAEC
FHILRNNVDSMLPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLGGSGRKGLTSILL
QQTTDTTGIIRPLGENSRGMDILYTGPMVPNPVTLLSHPLLGHILGILKKQYDAVIIDAPPYGILADTAILASLSDITLY
AVRSGKIDKRYLLQIQQLADQGKLPNMAYIINGVNFKSASYSYYGYGYGYQYGYGTKEPQQTSRKQDK
>gnl|bykdb|B1ZMW1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutus terrae] (length=724 residues).
MVPTSASKDSASLADFMQLLRQRKALIALILGLVLITTIVVTAFLPRWYLATTKIRVEKPEGEVKLFQAQSSSYYDPYFL
QDQFKIMQSEKILYPVIENLGLNTRLAPLLGATGPLPSAMTYRYLLNKMLAVESQRSSSLIEINVYAQEPPLAAAIANEI
ARVYSDDRIALATSEQREGLAHLRKELEAQEQVVSAQRDTVERLRKDLNISGVDLNARYSDMEIETLRQMQNSLIALSVD
AIGRRTRWERFKSIAPADRLSLVNSELIQDTNIQNLLQAYLVADQNVTRLQSRLGEAHPDLIAAVDNRAKIREQLDGQLR
GYESALEIAYQEADSRVAELKNQLAQAKVAQILSARERMRPFEEAAQKLEDETRLLTTLKLTLRQREIDFQVPKRTIEIL
NTAEPPRYPSRPNWTLSIALALVFGSLLGVGAALLLEYFDTSFRTVGDVETRLKLPVLGVIPRQTDPLGGDEDPAEAEPY
RVLQTNLNLALKPGQPASLVIFSAGPGEGKSTTLFRLARLAAAAGERVVLIDSDFRRPAQHRLAERPREPGLSDWLMNRQ
PLETIVQRELAPNLDFIPSGGVPGFTLGLLQVNRLKELIATLRGRYDKILFDSPPIIGVSDASVLASVMDGAVLLIQHRR
NPQSMVLRAQQIVEAIKTPLLGVVLTQVPENAGGDYGYYTHNYSYYSDGSHRRHRPGPSAAHQAAPAVEGDRLVLREPER
KDPA
>gnl|bykdb|B2UKW3 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=735 residues).
MSAQDQQNSDRIVRNIDYLQVLKNRWKEVFLVFLLVLVISVVVTFLMPPSYRATSQFQIKLPKPVMDIGRGGDVVATSNV
TANYIPMQYSVLTSAEVLKVVSRKLNLAAEWGMTDEMAATNLAGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAY
KQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTSWRNGEHRSTLTAGMEEEEFRNAKAQAMDFE
RREKELASYVQELQRLPDDKLLDYVISSDLLNAETVGADALRKTYAEFSDKLKEKENLKSQNIGARHPKMLALLETERIL
GDKLNKELIGLRSSLKSKLEMVAASRKHWEATVAQKEEDLQKHVLQVPMYEQASRDYDAALDQLKELDSRYKDEIARLRV
PREAIEMYQLPTYPAAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSD
VMGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKTTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNEVG
LTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDM
TLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSADGASSGENADASSMKKVERSGKA
KELAATQSHDSEDLY
>gnl|bykdb|B2UPB6 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila] (length=800 residues).
MTNNTAPTPPVTENTEETALSLDTVLTILRRYWFIIILAALAGGTAAYYLAGKQNYIYQKTASVLMRDAKTGSDASSERI
MAELNIDPNAANLANESLVLKSTALMNKVVEDLSLNTSYWQKKDFRELDLYHATPLLVHFEQIDKQRACTLNITPLDEKR
FMLGHPNDQGELILLEGFYGKPLTLPFATISVHPTSLMTDAWNGKTVIVRHSPVLETANALLRGLTITRPDSKESSLLEM
TLTSSNPQKAEDTLNHLIQVYNQISKDERNKASLKTKIFIRDRLKELGASLSDVDKKLTEFKTKSDIVKDADTTMSADFS
TSQALEKEIFDLETQIKLASTLADNLKESERKHGLISVETGLPDSGIARQIEHYNEAYLEYQKIAGSAGSQNPIAVSLRD
RMNSTRAAANKALSNYRSNLDLKLNQLINKRNSLTERLTETAIKEQEIIPLIREHKVKEELYLMLLSKEQENALAMAVTE
SNARVLETAHGSNLPISPKTIKYVAGGTAGGALLSILAFMGAAMLNNKVNNKHDLPAANRQPVIAELPQMSKKESKNTKL
FIQDEHSVIAECFHILRNNVDSMLPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLG
GSGRKGLTSILLQQTTDTTGIIRPLGENSRGMDILYTGPMVPNPVTLLSHPLLGHILGILKKQYDAVIIDAPPYGILADT
AILASLSDITLYAVRSGKIDKRYLLQIQQLADQGKLPNMAYIINGVNFKSASYSYYGYGYGYQYGYGTKEPQQTSRKQDK
>gnl|bykdb|B3DZK9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Methylacidiphilum infernorum] (length=741 residues).
MSEELQKKPKDNLTVGNKDVFQTEVLLSPYESSDLEWLKEKLWDIYRFRKQALLFFLVCLFVVFLFTFSQKPIYRGESVV
KINSTKSEVVPYKQVSNDEPGLFDWETFFKTQCEIIKSRSLAQRVVERLELDEHLDWLGLKPKKNGPLPSSEKLSEIVQN
NLHILPVRGTRLIRICYDSPNSFGAMQVANAYAESFITFGLDRKLEANRHARQFLAGQIELMKKKVTESEAKLARFMEKT
GIVKLPGVNSSPTEKELAQVSDALAKARFEMIRKEVFYERAKNGLDMGKSLTIPDNQYTMDIKKNLLKEQAKYRELEEIY
KEDYPKMVRLKAGIDGLNQQLAEEKQAVVEKLEAEYEAAKKNFESLEEEWKKTLLKLKDENSLLAKYAMLKREADANQQM
YMGLLKRLKETDITSALNSGNIEVVETASIPKKPVKPKKMLNLLLGLFGGSVGGIGLALGLALLDNRFRGKDDIEKFLKI
PVLGVIPDIEKLKKHQPETYEGDIPYALMTYALPESEVSNGFRSIRTLLHYTIAGRRPQVITVTSTLESEGKSGTTVNLA
TVLGQQGTVLVIDADLRRPSIHKILGLRPRPGLSEILTGQAQVEEAVQPTSLPNVWAIVGGRAALHPADLLGAESFSQLC
RSLREYFTYILIDTPPMRGMPDAPIVSMQSEGVLYVIEDGRDDRKEVQNNIEAFSRINSRVLGIILNRADPLSHSSYYYA
YKYRSQASSNSQELMRKEEEA
>gnl|bykdb|B4DB23 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Chthoniobacter flavus Ellin428] (length=713 residues).
MNDSNEVKLHFLDYWRIIRLRMGLILLTFFLVMVTAGVTTYFLPKKYYSKVTMEVKQDKSDLVQTFGPGQFRQTYDPQFV
ATQFQILQKTEILYPVIERLDLIKEFSPPGQRLPLQQVYIQLRNSMKLNEVRNTGLIEVGAKDTDAQRAANIANAIAVVY
QEERQHELDKNVARGLEQLKDEVDRRRKEMEDTSAVAMQIRAREGIVDSDPDKENSVISGGEGGNVLQRQQQVNEQQIKV
VELERQLEMINSLSPEQLQDALKTLGIDDTTVSRNLPLLQDAAAEHARLTNLGLGVNHPRIKALDAQMATYQKILGDQLN
TIKITQANRLRLEKDKLSGLQEMSKASRTDDIKEKASLVEYVDAKNKYIQARKLYESVELSYVTQKMNNSVKGDSAKIWE
KAEKAEYPSEPNVPAYMGMAAIIGLVLGVGLAFFIDYLDTSVKTLDDVERYLQIPVLAVIPNNVSILMKNAGDTSDAEAY
RILRAAVEFNKPYRDANTFTLISGGPGEGKSTTLNNLAYTCAKGGYNVLVVDADLRRASQHHFFDVDNSFGLTDYLLGRA
EIDEIIKTTKIDNLSFIPSGLLPGDSVGILNSQRMTDLIAKVKSQYDLVFFDSPPILGVSDGSVLASEVDVTIMVVQHRR
FPRVMLQRVKQAVLNVGGRLIGVVLNNVDAKHDDGYSYYYNYNEYYGPRRGTPKIEAPAPQLARPRDTHREDY
>gnl|bykdb|B9XAX1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Pedosphaera parvula] (length=719 residues).
MKLRLSNEREIAEMTEVDRPLDVQEFLQTLIEKWWLIVLVTCAVTLPAFWWVRNVPVGYQARAVLQVEQEEQRLVGIEEV
SRQDLRTGEMLNTIVQNVKNTKVLGRVVRNIGLATNSFFLPGNTNVLSEAKLVNALAGMIVTKLRPETRLVDITVTHPNA
EMAQKLANAVAQEFILESLDQRFSNTKAANELLYAEAGKLKQKVEMSERNLQAYKESNKTVSLEDRQNIIVEKLKGLNQK
YTSAKADRIQMEADLKLIQSLTNQPEAILTLPSILQDPAVMETRRRVVEQEAQVATLLLRYKPNYPKMLQAQRQLDDLKD
ALRSLASKAPKLVQSAYDGALARENNLEAALKEVQMESLDLDRKGIEYNVLMREVQSDLALYDSVLKRLKETDLSKGLEK
ASIAVVEPAMLPGATVKWSLLLVIGGAVVTGLLMSLCMIYLMSLFDSSIRTVDQAEFVLGLPVLAAIPVAKKGRNGTPAH
IVADDPGSICSEAFRTLRTTTGILGHEEGKRITLFTSADPNEGKTFFSLNHAICQAQGGKLTLLIDLDLRRPSVGESFSH
PPGTPGVTNYLLGKESLSTLVLKTPYPNLYILTAGPKVANPAEELGGDAIKQLLLEASNQFDRIVIDTPPINAVSDTFIL
LPLAQIICLVVRAGKTPKHAIMRAVELMARANVPPTGIVLNFLPQHSGYRYYYHYTPRNGYKSIGVYGNDYPAKIPLNT
>gnl|bykdb|B9XK55 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Pedosphaera parvula] (length=719 residues).
MDPLKTSAPPEAKLHFLDYWRIIRIRKTVILAVFLLVVITATIVTFILPEQFSSTARIKVEGDTTDVPGITQTPNYSGHY
DPYFIQTEFEVIQSEVILDRVIEGLNLNEAWKQYNNGQKLKTSQSRAQLKRMMELHPDRNTSLIEIKIYSNDKKEAAAIA
NEVAIVYQKYRLDQKLDITGAGIKVFKQQVQEQDDLIAKQEAKVDKLRKDLKVTDLGGESATGPQQTLEPMNVMHYNTLR
IDAETQYIKEEKLLSQLKQLKSDELKQAIPTAAPDAILIQLLQDLIGAETKLVTLLADYGDKHPEVLRTQKLVNELNAKI
DDRVKGIMVGMDARVASLLAVVKNSEDKVNEAKSNDLVLAESSRPYFIEKSQLDHLKKFREILEFRAAQEQVDRALPKTT
MVQIVDTAEEIDKPVRPNKALNIALGIIIGLVVGVGLAFFIEYLDTSVKTIDDVERTLQAPVLGVIPQNVGLLLDEGAES
PHAEAYRVLRTNLMFSRKDDKLNTMAVVSAGAGEGKSTTVYNMATVFAQSGHRVVMVDSDLRRPTLHKLVNVSNTIGLTN
YLLKQNTLEEVIQTTRLPNLDFMASGKLPSSSLGILSSAQMKDLITELKQRYDYVFFDSPPIMGVSDASILASEVDMTLQ
VIQYRRYPQPMNIRAKQLIEKVGGNLIGIVLNNINMSQDESYYYYSGYYHDYYSKNEDESETATDAGEGKARTDIKPKY
>gnl|bykdb|D5ENH7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Coraliomargarita akajimensis] (length=755 residues).
MKNDYVRGGADPNSGGYGGYGYGYGGGSYGYGGYGSGGGGAGYEQGPQRSAKDYLLMFRERIWWMIVAFFIIFSGAILYT
FNKTKVYTAVAQVRLLREDPAAMGDQVDLAQDSIRTAEDLNTQISLLNSSKIIQQVERRMSEEQRKKFMQPYEGAFSFSG
PLTASEILGKYRKIMPQRMSLMVSVTYTHPDSQMAADIANLFADEFINYKLTENIDASMVAVEGLRIRADRQKERVEELE
LELAEYREEHNAVSLDSQENIAREQLGSLNQIKLESKNNYDQFETKWKLIDSYKLEGKNLWELSFISEQPRVASLLQNIS
ATKIEIASLSKRYREKHPMMIQQLQTLQESEVELGEAVQNSVDKVYASYIEAKSNFELASQRLAEKESELIGLSKVRVEY
NSLLRELEVQQSFFQALNSRMTQEQAQVSLKEASARIVDKAFAPLRHSSPNILMNLAAGIFGGLVVGAGLVFLVAFLDDR
VKSAFDIEGTIGLPLLGVVPRIKKLDSNSKAQAVASNVDRHVTETFRSIHSAMKLNDESKNAKIIVTTSTVPSEGKSFVS
SNLALTFANHGEKTLLLDADLRLPNVAASMQLENERGVLDHVEKGMPIEDVTIREVYPNLDVIPTGGKSKNPTQVLVSAP
FEAMLADLRDRYDRIVIDSPPLAAVSDALNLLPLVDGVVYVIKFNTVKRKTAVANVRRLWESNTPVFGAILNNITTSLSS
YYYSQYSDKAYQDYYIHQEDEFEEELAGSVEPDKQ
>gnl|bykdb|I0JYY7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Methylacidiphilum fumariolicum] (length=773 residues).
MGEELQKIPEHNVPHNQIQDPNSLTAIPSDPYYSFSTGEWLKERFNEIYRYKAVVVISFLLILLFTILFTFTQKPVYRGV
ATIKINFNKSEVLPYKTVGEDQAGLFDFENFFKTQVEILKSRSLAQRVVERLDLDEHPDWLGLKKESFRKHSINPSEGIE
PTSEINLYAEYLLKNLQVTPVRNTRLVQIKFDSVNAQAAAQIANAYAEAFIAFGLDRKLEANQHARHFLAQQLDSMRKKL
ALAEEKLATFTEQTGIVKFPGVDRSPAEQELNRVSEAVSKARFEMIRREVYLEKAKAAMDAGKLAAIPDSPFTVDLKKIL
LKEQAKYRELEDIYKEEYPKMSRLRTEIEGLNKEISEEKEATIEKLEADYEAAKRHYESLEEEWKEAMVKVKKEGRLLSQ
YALLKREADTDREMYTGLLKRLKETDITSALNSGNIEVIETSPIPKVPVKPQKIRNILFALVFGSLTSCGLALGLAKLDT
RIRSKEEIEKQLGIPVLGSIPDIELIKGEGIDEIPKDIPFALTTYSSPESFVSNAFRQIRTLLHYAIPNRKPQLIAITST
YPSEGKSSTIVNLATVLGQQGTVLIIDGDLRKPSLHKSLGLRPRPGLSEILTGQVNIEEALQLSTIPNVWAISGGRAAIH
PTDLLGSESMHSLIQLVRQYFCYILIDTPPMHGMPDAAIIGSVTDGLIYVIQAGRIERKDFLQNLQILATVNARILGVVL
NKTTTSYQSYYSYYAYKEKNEIQNKNQTQSLSPFHSLQFLNDWVQEKIKRPDK
>gnl|bykdb|I6AQC1 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium TAV1] (length=750 residues).
MDSQAKQPKASDGRAEYGYGGYNEYPGYGNEASGQRTLSDYLLILRERIWYIVVVFLVIFSSALVYTFSQTKIFSSSATV
QIMRRPAMTLPTPELLPTNVISTEDMNTMVKIFESPTIIQKVSERITGDELRRFMQPYEKGRFGDPLTPLEVLGENRSIV
PFRMSLLVAIEYRHPDRLIAAKVANLFLEEFVQFNTRQRVDQTFGILEDLKLRAESQRKTVEDLNRQMQAYREKYNMGSL
DKTKDIQTRKLMEQGSLVTQSGARLSEATVRWQQVDERLKNNGDLLELPFIASNPLVSQLASQIAMQTITIKQLRERYKE
KHPKMIEASNALTQAQLELQKAVKIAAELVKSEYEAALNSNKEARAILAQIEKESFEIDKAAVDYQMIERDFLVNSSILD
NTIKRIRELDITSTIEGQNIQISPISRAVPAREDQYVEPRIVLNLAGGFVLGIGFGLAFAFVVAFIDDRVKSSFDIESVV
GLPLLGVIPQIKKMDQADKAQVALNNADRQVAEAFLTLHSSLRLRNDSKNAQTFLTTSTVPGEGKSFTTTNLALTFAAHG
DRVVVLDCDLRKPNIHKSFRRENLKGVIDVCAGSATIDDVVMRDVHPNLDVIATGGRAKNPTQILNSKNFEIMIAELRKR
YDRIFIDTPPLAAVSDALIILPLVSGSIFTIFFNKVRRKAAQHAARKLLESNVPVYGAVLNGLNLAVAGYYYAQYYDKSY
KDYYVMTESEEGEDTAEADDKVPEMPTSRS
>gnl|bykdb|R6J100 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila CAG:154] (length=798 residues).
MANNTAPTPPVTENTEETTSLDTVLLVLRRYWFIIILAALAGGTAAYYLAGRQNYIYQKTASVLMRDAKTSSDASSERIM
AELGIDSGAANLANESFILKSTALMKKVVEDLNLNTSYWQKKDFREIDLYKTSPLLVHFERIDKQRACTLQITPLDEKRF
MLSHSNNQGESVQLEGFYGKPLTLPFAVISIHPTSLMTDAWNEKTVIVRHKPVLETANNLLHGLTVTRPDAKESSLLEMS
LTASNPQKAEDVLNHLIQVYNQISKDERNKAALKTENFIQSRLKELGAALSDVDKKITEFKTKSDIVKDTDTTMSADFST
SQALEKEIFDLETQIKLAAILADNLKETERKQGLISVETGLPDSGIARQIEHYNEAYLEYQKIAGSAGSQNPITVSLRDR
MNSTRAAANKALSNYRSNLNLKLNQLISKRDSLTERLTETASREQEIIPLVREHKVKEELYLMLLSKEQENALAMAVTES
SARVLETAHGPNFPISPKTIQYIAGGTAGGALFSIFAFMGAAMLNNKVNNKHDLPSTNRQPVIAELPQMNKKESRNTGLF
IQDEHSVIAECFHILRNNVDSMLPRPEQGGHVILVTSTLPGEGKTFTSANLAAAFAYAGKKVLLIDGDFRKSSLTRRLGG
SGRKGFTSILLQQSSDTTGIIRPLRENSRGMDILYTGPMVPNPVTLLSHPLLGQILGILKKQYDAVIIDAPPYGILADTA
ILASLSDITLYAVRSGKIDKRYLLQIQQLADQGKLPNMAYIINGVNFKSSSYSYYGYGYGYQYGYGSGEPRQTTRKQD
>gnl|bykdb|R6K1U5 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia muciniphila CAG:154] (length=735 residues).
MSAQDQQNSDRIVRNIDYLQVLKNRWKEVFLVFLLVLVISVVVTFLMPPSYRATSQFQIKLPKPVMDIGRGGDVIATSNV
TANYIPMQYSVLTSAEVLKVVSRKLNLAAEWGMTDEMAATNLFGMIKVAPVRATDLVDVIVSGPDPKLVQNIAKAVPEAY
KQDREMRENRLVETAIKSLKDVLREQEDAVNEKMMALKKLIAESSYLPTSWRNGEHRSTLTAGMEEEEFRNAKAQAMDFE
RREKELASYVQELQRLPDDKLLDYVISSDLLNAETVGADALRKTYAEFSDKLKEKENLKSQNIGARHPKMLALLETERIL
GDKLNKELIGLRSSLKSKLEMVAASRKHWEATVAQKEEDLQKHVLQVPMYEQASRDYDAALDQLKELDSRYKDEIARLRV
PREAIEMYQLPTYPVAPYKPNVTINLAVGAGAGLLLGIGLALLLEFMDTSVKTMEDVERALQVPVLGIIPKNVPILHSSD
AMGPDAEAYRILRTNIEFNKKGLEEISLTFVSGSAGEGKSTTLCNLAYICAQGGYATLMIDADLRRSKLHRYYELDNEVG
LTSYLLEDYPLEEVIFQTPIENLYVMPAGPTPFDPSGALNSRKFNELLQEVKQRFDIVLVDSPPILGVSDSAVIVSEVDM
TLMVVQPRKLPLKALLRQKQVIESVGGNLAGVVMNNVDITSDHQYQYYTTYYSYYSADGSSSGENADASSMKKVERSGKA
KELAATQSHDSEDLY
>gnl|bykdb|R7DS70 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia sp. CAG:344] (length=789 residues).
MPDTPAPPAAPPAEEPESSLSLDVITSILLRRWYWILLFALLGGAGAYYVTGKQNYIFEKTASVIMRESNKDSSSSDRIK
VELGMDSGAANLANESFILRSSTVMRNTVEDLTLNVSYWKQQDLRQIDLYKDSPITVTFDDIAENRFCTFDVTLEPENAV
TLTYHDAAGNPIQEKGKLHAPISLPFATVTVYPTSNMPETVSGTTITVRRIPVNAAADQLLANFTVTRPDAKESSILQMT
LTSTNPDKAADTLNKLIAVYNDHSTEERRTKAVKTKDFIRRQRGQIGADLKEVDQKMDDIKIKNDIIADTEASISADFNA
AQTLDNSIFELQTQMKLADGLKENLDALGHKAGLISLDTGIADSGVSRQIEAYNAAYLEYQKVAGSAGGQNPIVVTLTKR
MDATRSAASRSLDNLRNNLELKLQELTRKRQDIAKRLTATSGKARELTPLDREHRVKEELYLTLLSKELENDLTLALTES
SARVLESAHGTDYPISPNTRKSVLTAAAGGAIVCILGFLGLALLNNKIKNRKDLNAVTHLPVVAELPAMTKKEQRQVARM
FTDEHSVISEYFQILCHNADSMLPVTRNQGHVILLTSTMQGEGKTFISANLAMSFANIGKRVLVIDGDLRKASLSKQLDG
KGRKGLSTILLRKVEDPFSVIRTLPEHPGVDILYAGPQVPNPVTLLSLPEMEELIRLFKERYDAVIIDSPPYGILADTAI
LASHADISLYVIRSNRIDKRHIATVQQLAESGQLPNMGFVINAVDFKSSSYSYYGYGYHYGNTSKNNPS
>gnl|bykdb|R7DZW0 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Akkermansia sp. CAG:344] (length=793 residues).
MKDLSPKKETLDVGGAAPASLLPSPRAIMGRIVRKWYWCVLSLCICLPLAYLYAARQPQVYGKATTILIKDDYPRESVAA
TVLASTNGIVNTGATNLDNEIFLLSSHSLLKTVVRNLKLDVTYWKKNGFRKVEIYQDSPIAVQFTQEGKTADARFLVIPV
SGTEFRLEKDEKDHHGHETGVFGKEIRFDSQAFIVEKTSKFDESSLNVPVIVRRTSVKNAAMGLGSGLTVRKASGKNDLI
NISMRCNNPVKAEDILYSIVHFYNEASLEEKNKRGTKTNEFIGDRLDVISEEMKKNDLAIEDLKKETDVLTDLSTALTEE
YENSLNDKKDLRELELEIKSIEYLKDYLEQEAEHDARLVPINSKIADMGIRDQISVFNDTLLKRTSLKVNAGDNNPIIRE
LEANLNSLKDALKRSVNNYYTSLLVKKKNVQDQHEQTREHIRNVSSRERAVNHIEREQRVRESLYVLLLNKREENSLALA
ATEDNARMVDGVRGGNGPLEPNVPKILMVGFLAGMAIPVFLCVVAAMLDSSVKRRKEIETLTSIPVYGELPRKPRKLKNQ
EIVVNLEEPSELSECFPLLAERMVALSDGNEGNPLSVLITSTCSGEGKTYLSVNLALSLAVAGKKVLLMDMDLRKGALSA
LLGGAGKPGLGDLEQAGEGGWRSLVEQSPVSDHLDYLFAGTVPDHPSRLLLHDRIRKLMEEVKEQYDFIFMDCVPYSSLA
DARIVARLADVTLYVMRAGCVKKRDLAGLQKIWKNGELKRMGIVLCDVEPHGRSSRGYAVYRSLDTSSPCAGK
>gnl|bykdb|R7L5A9 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Coraliomargarita sp. CAG:312] (length=797 residues).
MESSNNNNSQPDSAPTKVIKKKIVASYGSGGYGGYGGYGDYGGYGAYGGGYGGYGGYGGSYGGYYGGYNSKNPAGEGGVP
NRTFRDYMMILRERFWYIIVTFFIIFAGVLLYTFRITPIYTSAASVQILRDSDSPIDGPGSTERSRNNVIMSMEDFNTQV
KLFESAEIVKAVKSRMKEDELKRFIAPYHNMFTFGIRKSEEELLMDNRSIIPQRMSLIVTVIFEHPDNNMAARIANLFAT
EFINYTHQKRVQALMGSIDELRTKVSQQEAKVKELDKKLVEYREKNGAVSLDTLDDVDRTELRDINAILTNDKRIFDAAS
TQWTLMQEYKRDGKDLCTLPFISEFQQIAKLLTDRSTQQVFIASLEKRYKEKHPSMIEARKTLDQIEKELALAVDAAYAK
VQASYETARQNYEQSQKRLAEKKEEILSLGKKAIIYKSLERERMVAEGMHASLISAMNVRTAQVSLINEGASIIDRAAPA
LRPSSPNYVLNIILGIIAGIIGGICMAFLVAFLDDRAKSAYDIEAVIGLPLLGVIPRIKRLNSAEKAQVAASNADRATTE
AFRSLHSTLKVNNFSKNAKVILFTSTTPSEGKSFIVTNLAFTYALHGEKTIIIDADLRLPAMAKVLGITAKDGLIGHIEE
GKPLEDAIIHDYFPNLDVLVCEKRAKNPTQTLNSEEFAAMIEKFRDTYDRIFIDSPPIGAVSDAITLLPTVDGVIYVVKF
NTVKRKTIRAYIRRMMESNVPILGAVMNMVNPSSASVYSMNYYDKSYQNYYTAPMESDEDEQPPEDVPPEMPSESKQ
>gnl|bykdb|W0ITH7 [Bacteria] Bacterial tyrosine kinase [Verrucomicrobia][Opitutaceae bacterium TAV5] (length=750 residues).
MDSQAKQPNPSDGRAEYGYGGYNEYPGYGNEASGQRTLSDYLLILRERIWYIVVVFLVIFSSALVYTFSQTKIFSASATV
QIMRRTAVTLPTQNPIDNNVLSTEDMNTMVKIFESPTIIQKVSERITGDELRRFMQPYEKGRFGDPLTPLEVLGQNRSII
PFRMSLLVAIEYRHPDRLIAAKVANLFLEEFVQFNTRQRVDETFGILEDLKLRAESQKKKVEDLNRQMQAYREKYNMGSL
DKTKDIQTRKLMEQGSLVTQSGARLSEATVRWQQVEDRIKANGDLLELPFIANNQLVAQLASQVAMQTITVKQLRERYKE
KHPRMIEANNALTQAQLELQKALKIAAELTKSEYQTAFNADKEARGALAQIERDSLNMDKIGVDYQMLEQDFLINREILD
RTIGRIREIDLTSTIEGQNVQIRPISRAVPAREDEYVEPRIVLNLAGGFILGIGFGLAFAFVVAFIDDRVKSSFDIESVV
GLPLLGVIPQIKKMDQADKAQVALNNADRQVAEAFLTLHSSLRLRNDSKNAQTFLTTSTVPGEGKSFTTTNLALTFAAHG
DRVVVVDCDLRKPNIHKSFRRENLKGVIDVCAGSATIDDVVMRDVHPNLDVIATGGRAKNPTQILNSKNFEIMIAELRKR
YDRIFIDTPPLAAVSDALIILPLVSGSIFTIFFNKVRRKAAQHAARKLLESNVPVYGAVLNGLNLAVAGYYYAQYYDKSY
KDYYVMTESEEGEDTAEADDKVPEMPTSRS
© 1998-2019