BYKdb

Annotate results for A0A009E7X8

A0A009E7X8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A009E7X8
DOMAINtad1/204DNKGASAALLGDLSNMIEQKSPAQAEIEILKSRLVLGSVINQLNLDLVISGTEDSIWNRL
LKNHNYDIKYSTKSVLFKDNQQSFDVRQFDIPNYYKNKNLLLSFDHNKYNLTDAETNDII
FTAPLNQTSQIQSRYGLWKVAIYSKDLLDSTYNIQKLTLPAAVQRVLNDYSVAEKGKMTG
VLGLNYQGQDKQHITQVLNAILTA
DOMAINcd480/668SGPAPEIGKSFITTNLATILAQSGSRVLVIDGDLRRGYLNKYFNKEVQPGLSELLNHQNS
YEDVVQNSQVNNLFFVTRGKSPVNPSELLSTDKFKVFLDQASASFDYVLIDTPPVLAVTD
GIIIAQYAGVNLLIARHGKTQIKELEITVTRFEQANVKVNGVILNDVQKGPGNGYGYGYN
YAYAYKTSK
SITEWalker A487/489GKS
SITEWalker A'507/514LVIDGDLR
SITEWalker B587/593VLIDTPP
SITE-517/-521YLNKY
SITE-558/-560GKS
SITEY Cluster654/664YGYGYNYAYAY
SITE-617/-619GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNKGASAALLGDLSNMIEQKSPAQAEIEILKSRLVLGSVINQLNLDLVISGTEDSIWNRLLKNHNYDIKYSTKSVLFKDN
DNKGASAALLGDLSNMIEQKSPAQAEIEILKSRLVLGSVINQLNLDLVISGTEDSIWNRLLKNHNYDIKYSTKSVLFKDN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQSFDVRQFDIPNYYKNKNLLLSFDHNKYNLTDAETNDIIFTAPLNQTSQIQSRYGLWKVAIYSKDLLDSTYNIQKLTLP
QQSFDVRQFDIPNYYKNKNLLLSFDHNKYNLTDAETNDIIFTAPLNQTSQIQSRYGLWKVAIYSKDLLDSTYNIQKLTLP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAVQRVLNDYSVAEKGKMTGVLGLNYQGQDKQHITQVLNAILTAYSQQNIERRSAESAQTLKFLDEQLPELSQQLDQVER
AAVQRVLNDYSVAEKGKMTGVLGLNYQGQDKQHITQVLNAILTA                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFNQFRQQYNTVDLTKESELYLTQSIALETQKAELELKVAEASARYTEEHPVMEQMNAQLGAINSKIAALSNTLKQLPDL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRRYLQLYREVEVKQQLYTGLLNTYQQLRIAKAGEIGNVRIVDTAVEPIEPIKPKKLQIIILSIFLGGFLGTLLALLRNM


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRSGIKDSAQIERELDLPVYATVPRSPLQESRVNLLKKKKSIPILAVKDSSDIAIESLRSMRTAIHFALSNAKNNIIALS
                                                                               S

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPAPEIGKSFITTNLATILAQSGSRVLVIDGDLRRGYLNKYFNKEVQPGLSELLNHQNSYEDVVQNSQVNNLFFVTRGKS
GPAPEIGKSFITTNLATILAQSGSRVLVIDGDLRRGYLNKYFNKEVQPGLSELLNHQNSYEDVVQNSQVNNLFFVTRGKS
      GKS                 LVIDGDLR                                              
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVNPSELLSTDKFKVFLDQASASFDYVLIDTPPVLAVTDGIIIAQYAGVNLLIARHGKTQIKELEITVTRFEQANVKVNG
PVNPSELLSTDKFKVFLDQASASFDYVLIDTPPVLAVTDGIIIAQYAGVNLLIARHGKTQIKELEITVTRFEQANVKVNG
                          VLIDTPP                                               
       650       660       670 
....:....|....:....|....:....|.
VILNDVQKGPGNGYGYGYNYAYAYKTSKDGD
VILNDVQKGPGNGYGYGYNYAYAYKTSK   
             YGYGYNYAYAY       
© 1998-2019