BYKdb

Annotate results for A0A009G8E9

A0A009G8E9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A009G8E9
DOMAINtad9/264DTIDLKELFFSLIAQWKLIVLCILISLVCALIYLRVTPNTYSVDALVQVEDTKSAASAAL
LGELSKMVDQKSPAQAEIEVLTSRMVLGQVINNLNLDITIKNHDDTFFNRLLSQDKQNID
YKKDAVTFSNKDSYFSIQQLQIPSYYLDKPLLLSFKDQRHFTFSYKDKVIFSGQLNSNNL
VTAREGQWKVRINSTHAPSVEQQFTISKLALPTAVQKLGSTYGVAERGKQTGVISLNYQG
TDKEHITEVLNNILAV
DOMAINcd540/728AGPSPEVGKSFISTNLATIFAQSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQAD
LSQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLLEKFQTQYDHIIIDTPPVLAVTD
GIIISQYTGVNLIVARYAKSHMKELELTINRFEQAGVKVNGFILNDIQRSSGGGYGYNYA
YAYKAQKED
SITEWalker A547/549GKS
SITEWalker A'567/574LLIDADMR
SITEWalker B647/653IIIDTPP
SITE-577/-581YMHKY
SITE-618/-620GKS
SITEY Cluster714/722YGYNYAYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQTSKTEDTIDLKELFFSLIAQWKLIVLCILISLVCALIYLRVTPNTYSVDALVQVEDTKSAASAALLGELSKMVDQKS
        DTIDLKELFFSLIAQWKLIVLCILISLVCALIYLRVTPNTYSVDALVQVEDTKSAASAALLGELSKMVDQKS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAQAEIEVLTSRMVLGQVINNLNLDITIKNHDDTFFNRLLSQDKQNIDYKKDAVTFSNKDSYFSIQQLQIPSYYLDKPLL
PAQAEIEVLTSRMVLGQVINNLNLDITIKNHDDTFFNRLLSQDKQNIDYKKDAVTFSNKDSYFSIQQLQIPSYYLDKPLL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSFKDQRHFTFSYKDKVIFSGQLNSNNLVTAREGQWKVRINSTHAPSVEQQFTISKLALPTAVQKLGSTYGVAERGKQTG
LSFKDQRHFTFSYKDKVIFSGQLNSNNLVTAREGQWKVRINSTHAPSVEQQFTISKLALPTAVQKLGSTYGVAERGKQTG

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VISLNYQGTDKEHITEVLNNILAVYHSQNIERRTLESKQTLDFLDKQLPDLKQQLEESERKFNQFREKYNTVDVTQEAEL
VISLNYQGTDKEHITEVLNNILAV                                                        

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLKQNIALETTKTELKQKQAELAAKYTNDHPLMAEINAQLAAVNKKSAELSDTLKRLPEVQRQYLQLYRDVKVNTELYTS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLNSYQQLKIAKAGEIGNVRIIDTAVEPVNPIKPKTLIVLVLTIFIGGFIGILIALLRNMLRTGVKDSTQIENDLNLPVY


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATVPRSPIQETRMNILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTTAKNNIIMIAGPSPEVGKSFISTNLATIFA
                                                           AGPSPEVGKSFISTNLATIFA
                                                                  GKS           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLSQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLLEKF
QSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLSQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLLEKF
      LLIDADMR                                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTINRFEQAGVKVNGFILNDIQRSSGGGYGYNYAY
QTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTINRFEQAGVKVNGFILNDIQRSSGGGYGYNYAY
      IIIDTPP                                                            YGYNYAY
        
....:...
AYKAQKED
AYKAQKED
AY      

© 1998-2019