BYKdb

Annotate results for A0A010P567

A0A010P567 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A010P567
DOMAINtad13/195ELIDLGHYLGIIKRYSLRILLLALAFTVLVAILVMKMTPLYTSSTTLLIEAEKANVVSIE
EVYGIDTKSKDYMATQFEVLKSRQIAEKTVESLSLYDNADFMPEENETSFVSEIAEVFPF
LPQTEKVELTEEQKVAKLKRKATQILMSATDVSLIKGTQLVRISVTTETPSLSALIANTI
AEV
DOMAINcd538/728TSSVPKEGKTTVSINLAFALGQLDKTILIDADLRRPSIGKQFNIPSYQPGVANLVLKSHS
FEECLVRDEESNIDILSAGTIPSNPQELLADKGFEELITKLKSEYKYVVVDTAPTQAVSD
SMIVANSCDSVIYVVRADSTSDKVINNGLSRFLQVGHRLDGVVLNQVNLRKSDVAQRYAG
FYDQYGYTSHK
SITEWalker A545/547GKT
SITEWalker A'564/571ILIDADLR
SITEWalker B645/651VVVDTAP
SITE-642/-644YKY
SITEY Cluster715/724YAGFYDQYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAVKITEDTDNNELIDLGHYLGIIKRYSLRILLLALAFTVLVAILVMKMTPLYTSSTTLLIEAEKANVVSIEEVYGIDTK
            ELIDLGHYLGIIKRYSLRILLLALAFTVLVAILVMKMTPLYTSSTTLLIEAEKANVVSIEEVYGIDTK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKDYMATQFEVLKSRQIAEKTVESLSLYDNADFMPEENETSFVSEIAEVFPFLPQTEKVELTEEQKVAKLKRKATQILMS
SKDYMATQFEVLKSRQIAEKTVESLSLYDNADFMPEENETSFVSEIAEVFPFLPQTEKVELTEEQKVAKLKRKATQILMS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATDVSLIKGTQLVRISVTTETPSLSALIANTIAEVYIENYLQAKLDMTAKATSFLTDSIDGLKTKLDVAERNLVRFYETN
ATDVSLIKGTQLVRISVTTETPSLSALIANTIAEV                                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVVNIDGVVGLASDELERLNIQLSEAEVELKLNSVIFNQIKDSKAIEDVARIPEVLNHPAVRDVRRDEGKALARVSELSK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VYGPKHPKMIAANAELTAIRDTLNTQITDLISSITTQYESSKQKVAQLQREVETSKAAFRSLAELDNKRKALEREVDINQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLYDSFFTRLKETDELGGLESANARVLDTALPSYTPSKPNKKLFIAAAFVLSVSFGIALAIVMETLNSGIRSVEDVEKKL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQRMLGLIPWLAHKKKTDLPIRSFFDGKKHQFAEAVRTLRTSLSLLNIEKENQAILVTSSVPKEGKTTVSINLAFALGQL
                                                         TSSVPKEGKTTVSINLAFALGQL
                                                                GKT             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DKTILIDADLRRPSIGKQFNIPSYQPGVANLVLKSHSFEECLVRDEESNIDILSAGTIPSNPQELLADKGFEELITKLKS
DKTILIDADLRRPSIGKQFNIPSYQPGVANLVLKSHSFEECLVRDEESNIDILSAGTIPSNPQELLADKGFEELITKLKS
   ILIDADLR                                                                     
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EYKYVVVDTAPTQAVSDSMIVANSCDSVIYVVRADSTSDKVINNGLSRFLQVGHRLDGVVLNQVNLRKSDVAQRYAGFYD
EYKYVVVDTAPTQAVSDSMIVANSCDSVIYVVRADSTSDKVINNGLSRFLQVGHRLDGVVLNQVNLRKSDVAQRYAGFYD
    VVVDTAP                                                               YAGFYD
       730
....:....|
QYGYTSHKSS
QYGYTSHK  
QYGY      

© 1998-2019