BYKdb

Annotate results for A0A010ZC45

A0A010ZC45 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A010ZC45
DOMAINcd40/232TSSTPNEGKTSISFQLASSFAAADNRVLFVDADIRKSVIAGRYKVDGNTYGLTHYMTGQR
SMEEVICQTDIKNMDIILAGPVSPNPTELLGGPLFAKLLEEQRDNYDYIIVDAPPLGSVI
DAALIARYVDGAIIVVESAVISYKMLQRVKEQLEKSECRILGVVLNKIDMEHDAYYGNYY
GKYYGKYYGNYGE
SITEWalker A47/49GKT
SITEWalker A'67/74LFVDADIR
SITEWalker B148/154IIVDAPP
SITE-89/-147YGLTHYMTGQRSMEEVICQTDIKNMDIILAGPVSPNPTELLGGPLFAKLLEEQRDNYDY
SITEY Cluster214/230YYGNYYGKYYGKYYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRKVSFRRKDKLDFKANEAFKTLRTNILFSGKDIKVLTLTSSTPNEGKTSISFQLASSFAAADNRVLFVDADIRKSVIAG
                                       TSSTPNEGKTSISFQLASSFAAADNRVLFVDADIRKSVIAG
                                              GKT                 LFVDADIR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYKVDGNTYGLTHYMTGQRSMEEVICQTDIKNMDIILAGPVSPNPTELLGGPLFAKLLEEQRDNYDYIIVDAPPLGSVID
RYKVDGNTYGLTHYMTGQRSMEEVICQTDIKNMDIILAGPVSPNPTELLGGPLFAKLLEEQRDNYDYIIVDAPPLGSVID
                                                                   IIVDAPP      
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
AALIARYVDGAIIVVESAVISYKMLQRVKEQLEKSECRILGVVLNKIDMEHDAYYGNYYGKYYGKYYGNYGE
AALIARYVDGAIIVVESAVISYKMLQRVKEQLEKSECRILGVVLNKIDMEHDAYYGNYYGKYYGKYYGNYGE
                                                     YYGNYYGKYYGKYYGNY  
© 1998-2019