BYKdb

Annotate results for A0A011JTX5

A0A011JTX5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A011JTX5
DOMAINtad1/213MVQVEDSKGAASAALLGDLSKVSGGLTQKSPADPEIEILRSRMVLGQVIHNLNLDIKIKD
NRLGLIGKLVSQDKSKLEYHHDAVIYTNQNNSLIVKKLIVPEYYLDKPLKLEFKGESQFT
LTYKDRVVFNGQLNKKNILNTDKGLWQIQLNAQGNLQKQSYTLTKLALPTAVKNFNDIYS
VAEKGKMTGVIGLSYLGQDPEHISQVLNNVLNV
DOMAINcd489/677AGPSPEVGKSFISTNLATIFAQGNKRVLLIDADMRRGYMHKYFDIDVKPGLSELLSGQAD
LTQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLLEKFQTQYDHIIIDTPPVLAVTD
GIIISQYTGVNLIVARYIKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYNYA
YAYKAQKED
SITEWalker A496/498GKS
SITEWalker A'516/523LLIDADMR
SITEWalker B596/602IIIDTPP
SITE-526/-530YMHKY
SITE-567/-569GKS
SITEY Cluster663/671YGYNYAYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVQVEDSKGAASAALLGDLSKVSGGLTQKSPADPEIEILRSRMVLGQVIHNLNLDIKIKDNRLGLIGKLVSQDKSKLEYH
MVQVEDSKGAASAALLGDLSKVSGGLTQKSPADPEIEILRSRMVLGQVIHNLNLDIKIKDNRLGLIGKLVSQDKSKLEYH

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HDAVIYTNQNNSLIVKKLIVPEYYLDKPLKLEFKGESQFTLTYKDRVVFNGQLNKKNILNTDKGLWQIQLNAQGNLQKQS
HDAVIYTNQNNSLIVKKLIVPEYYLDKPLKLEFKGESQFTLTYKDRVVFNGQLNKKNILNTDKGLWQIQLNAQGNLQKQS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YTLTKLALPTAVKNFNDIYSVAEKGKMTGVIGLSYLGQDPEHISQVLNNVLNVYHQQNIERKSLESKQTLAFLEKQLPDL
YTLTKLALPTAVKNFNDIYSVAEKGKMTGVIGLSYLGQDPEHISQVLNNVLNV                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKQLEDSEIKFNQFREKYKTVDVNAESELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIRQIDAQIAEINKKIADLN


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NRLTQLPETQRLYLQLYRDVKVNTELYTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPIKPNKLIILALSILAGGFIG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIALLRNMMRSGVKDSTQIETELDLPVYATVPRSPIQETRMSILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKNNIIMIAGPSPEVGKSFISTNLATIFAQGNKRVLLIDADMRRGYMHKYFDIDVKPGLSELLSGQADLTQVLHKTQVAN
        AGPSPEVGKSFISTNLATIFAQGNKRVLLIDADMRRGYMHKYFDIDVKPGLSELLSGQADLTQVLHKTQVAN
               GKS                 LLIDADMR                                     
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDVITRGKSPTNPSEMLSSTQFKDLLEKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYIKSHMKELELTVNRF
LDVITRGKSPTNPSEMLSSTQFKDLLEKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYIKSHMKELELTVNRF
                                   IIIDTPP                                      
       650       660       670       
....:....|....:....|....:....|....:..
EQAGVKVNGFILNDIQRSSGGGYGYNYAYAYKAQKED
EQAGVKVNGFILNDIQRSSGGGYGYNYAYAYKAQKED
                      YGYNYAYAY      
© 1998-2019