BYKdb

Annotate results for A0A011Q7V8

A0A011Q7V8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A011Q7V8
DOMAINtad37/289EGLALGEIIAVLMDYRWLIAATCLFALIIGLAWVVVASPTYRADGLLQIEEKKGSGGVLK
ALEPLLGDTTTAPAEVEILGSRMVLGRVVSKLRLDIIARPRTFPLIGSAVVRRYEGDQPA
SPWLGLSGYAWGGERIQVDSLDVPQQALDEAHTLVAGAGGSFEIFNDDDELVLSGTAGTR
ATNKGYSVFIAQLEARPGTRFRLVKLSAETAIESLRKNYSVKERGKKTGVLELSLVGKRA
DEIVQILDDIMNT
DOMAINcd565/753TGSSPGLGKSFISKNLGAVLAQVDKRVVIVDADLRRGHLHKEFGIERAVGISEYVAGQAL
LDDVLKSTAIPGLTVVTTGQIPPNPSELLMHPRFEVLLGELAAKFDNVIVDAPPVLAVSD
AAIIGRHVGATLMIARAGKHPIRELEQAVKRLNQAGVQVKGFVFNDLNVSRQSYRYGYKG
YVYRYSYRT
SITEWalker A572/574GKS
SITEWalker A'592/599VIVDADLR
SITEWalker B672/678VIVDAPP
SITEY Cluster738/751YRYGYKGYVYRYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEHDQLRPPTYTAPGMSASGPQQAYATPAVTTPEDEEGLALGEIIAVLMDYRWLIAATCLFALIIGLAWVVVASPTYRAD
                                    EGLALGEIIAVLMDYRWLIAATCLFALIIGLAWVVVASPTYRAD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLLQIEEKKGSGGVLKALEPLLGDTTTAPAEVEILGSRMVLGRVVSKLRLDIIARPRTFPLIGSAVVRRYEGDQPASPWL
GLLQIEEKKGSGGVLKALEPLLGDTTTAPAEVEILGSRMVLGRVVSKLRLDIIARPRTFPLIGSAVVRRYEGDQPASPWL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLSGYAWGGERIQVDSLDVPQQALDEAHTLVAGAGGSFEIFNDDDELVLSGTAGTRATNKGYSVFIAQLEARPGTRFRLV
GLSGYAWGGERIQVDSLDVPQQALDEAHTLVAGAGGSFEIFNDDDELVLSGTAGTRATNKGYSVFIAQLEARPGTRFRLV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLSAETAIESLRKNYSVKERGKKTGVLELSLVGKRADEIVQILDDIMNTYVRQNVERRSAEAEKTLKFLDTQLPALKTQV
KLSAETAIESLRKNYSVKERGKKTGVLELSLVGKRADEIVQILDDIMNT                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSAEGAYNSYRQSRGSLDLSLETQGILKSLVEVENAAVLLKQERDELRQNFTPEHPRIQAVDSKLARLNERRKQFDGEVS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLPDTQQTVLRLARDVEVSNRLYTELLNTAQQLRVSKAGTVGDVRVIDTAAVGREPVGAKPVAILGIALLLGMLASLVVI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WVLRSLRVVVEDPEVIESQLGLPVYATVPHSKLEVDLHRKVQAGAVGELLAVAHPQEDAVESLRGLRTTLHFALLDAQRN


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLLITGSSPGLGKSFISKNLGAVLAQVDKRVVIVDADLRRGHLHKEFGIERAVGISEYVAGQALLDDVLKSTAIPGLTVV
    TGSSPGLGKSFISKNLGAVLAQVDKRVVIVDADLRRGHLHKEFGIERAVGISEYVAGQALLDDVLKSTAIPGLTVV
           GKS                 VIVDADLR                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTGQIPPNPSELLMHPRFEVLLGELAAKFDNVIVDAPPVLAVSDAAIIGRHVGATLMIARAGKHPIRELEQAVKRLNQAG
TTGQIPPNPSELLMHPRFEVLLGELAAKFDNVIVDAPPVLAVSDAAIIGRHVGATLMIARAGKHPIRELEQAVKRLNQAG
                               VIVDAPP                                          
       730       740       750   
....:....|....:....|....:....|...
VQVKGFVFNDLNVSRQSYRYGYKGYVYRYSYRT
VQVKGFVFNDLNVSRQSYRYGYKGYVYRYSYRT
                 YRYGYKGYVYRYSY  

© 1998-2019