BYKdb

Annotate results for A0A011QU98

A0A011QU98 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A011QU98
DOMAINcd53/233TSAGPASGKSTIAANLAATFASKEKKVLLVDADLRKPTVHKTFKVRNTDGLTTLLTDRNA
HLDEMIYRTHTEGLYTLTSGAIPPNPAELLASKRMEEIKQEMLALFDLIIFDMPPVLAVT
DAQVMATKADGVLFVIPQGSANKDEVMKAKDLLEKVQANVLGAVLNRVDKSDDSYYYYYG
E
SITEWalker A60/62GKS
SITEWalker A'80/87LLVDADLR
SITEWalker B161/167IIFDMPP
SITEY Cluster227/231YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIFSKKKKADTGERPGLVVVNKPSSVVSEQFRTIRTNIQFSMVDEDLKTVVVTSAGPASGKSTIAANLAATFASKEKKVL
                                                    TSAGPASGKSTIAANLAATFASKEKKVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDADLRKPTVHKTFKVRNTDGLTTLLTDRNAHLDEMIYRTHTEGLYTLTSGAIPPNPAELLASKRMEEIKQEMLALFDL
LVDADLRKPTVHKTFKVRNTDGLTTLLTDRNAHLDEMIYRTHTEGLYTLTSGAIPPNPAELLASKRMEEIKQEMLALFDL
LVDADLR                                                                         
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
IIFDMPPVLAVTDAQVMATKADGVLFVIPQGSANKDEVMKAKDLLEKVQANVLGAVLNRVDKSDDSYYYYYGE
IIFDMPPVLAVTDAQVMATKADGVLFVIPQGSANKDEVMKAKDLLEKVQANVLGAVLNRVDKSDDSYYYYYGE
IIFDMPP                                                           YYYYY  
© 1998-2019