BYKdb

Annotate results for A0A011RN54

A0A011RN54 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A011RN54
DOMAINcd52/231TSAVQGAGKSFVAANLSSTFALENKRVLLVDADLRKPTVHRTFNFNNHSGLTTLLTHPNE
ALSDLVYLTDMGNLSVLTSGPIPPNPSELLATKRMEELIEMMESEYDLVIFDMPPILAVT
DAQIMSGRVDGVIFVIPNGKATKDEVMKSKKMLDMIHANVIGAVMNRMVPSKHSHYYYKE
SITEWalker A59/61GKS
SITEWalker A'79/86LLVDADLR
SITEWalker B160/166VIFDMPP
SITEY Cluster227/229YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSVNSHKHRVDKQTAIIVKTKPGSVVSEQFRTVRTNIQYSMVDKSLKSIVITSAVQGAGKSFVAANLSSTFALENKRVLL
                                                   TSAVQGAGKSFVAANLSSTFALENKRVLL
                                                          GKS                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDADLRKPTVHRTFNFNNHSGLTTLLTHPNEALSDLVYLTDMGNLSVLTSGPIPPNPSELLATKRMEELIEMMESEYDLV
VDADLRKPTVHRTFNFNNHSGLTTLLTHPNEALSDLVYLTDMGNLSVLTSGPIPPNPSELLATKRMEELIEMMESEYDLV
VDADLR                                                                         V
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
IFDMPPILAVTDAQIMSGRVDGVIFVIPNGKATKDEVMKSKKMLDMIHANVIGAVMNRMVPSKHSHYYYKE
IFDMPPILAVTDAQIMSGRVDGVIFVIPNGKATKDEVMKSKKMLDMIHANVIGAVMNRMVPSKHSHYYYKE
IFDMPP                                                            YYY  
© 1998-2019