BYKdb

Annotate results for A0A014N794

A0A014N794 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A014N794
DOMAINtad16/253TGWDLAHIVGQLVDHRWIIVAVTALFMLLGTLYSLFATPIYSADAMVQVENKNVNTVLND
LQSMMPNAQPMSATEVEIVTSRMVIGKTVKDLGLDALVQQNYLPVIGKGLSRLLGNKPGE
VDVTQLSVPLSWEKPQLSLEVTGADSYTVSKDGDELFKGKVGQLENHGGVTMMVKSIVGV
KPDTSFTVTKLTDLQAISLVTNNLTVADKGKDTGVLGLEYLGEDPVQISRVLNQIVTN
DOMAINcd536/725TGASPGIGKTFICSNLATLVAKADQKVLLIDGDMRRGYTHQLLGANNKTGLSDVLSGKTE
FSSELVQKGAWGFDFLPRGQVPPNPSELLMHNRMNELLHWASMNYDLVLIDTPPILAVTD
ASIIGKLAGTSLMVVRFETNTLKEVEFSYRRFMQNGIDIKGVILNAVVRKASNAFGYGYD
YYDYSYKQDA
SITE-592/-594GKT
SITEWalker A'563/570LLIDGDMR
SITEWalker B643/649VLIDTPP
SITEY Cluster712/721YGYDYYDYSY
SITEWalker A543/545GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNIKSKASSASHEESTGWDLAHIVGQLVDHRWIIVAVTALFMLLGTLYSLFATPIYSADAMVQVENKNVNTVLNDLQSMM
               TGWDLAHIVGQLVDHRWIIVAVTALFMLLGTLYSLFATPIYSADAMVQVENKNVNTVLNDLQSMM

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PNAQPMSATEVEIVTSRMVIGKTVKDLGLDALVQQNYLPVIGKGLSRLLGNKPGEVDVTQLSVPLSWEKPQLSLEVTGAD
PNAQPMSATEVEIVTSRMVIGKTVKDLGLDALVQQNYLPVIGKGLSRLLGNKPGEVDVTQLSVPLSWEKPQLSLEVTGAD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SYTVSKDGDELFKGKVGQLENHGGVTMMVKSIVGVKPDTSFTVTKLTDLQAISLVTNNLTVADKGKDTGVLGLEYLGEDP
SYTVSKDGDELFKGKVGQLENHGGVTMMVKSIVGVKPDTSFTVTKLTDLQAISLVTNNLTVADKGKDTGVLGLEYLGEDP

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQISRVLNQIVTNYVDQNIDRKSAEAQKSLEFLKIQLPDVRAKLDEAEDKLNTFRRQNDSVDMSMEAKSALDSSVSIQSQ
VQISRVLNQIVTN                                                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNELTFREAEVSQLFTKDHPTYRALLEKRQTLVDEQKRVNQKIGQMPQTQQEIVRLTRDVQSGQEIYMQLLNRQQELNIS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KASTVGDVRIVDPAETAAAPVAPKKLLVVLASMILGMMVSVGVILLKALFHHGIERPDELEERGINVYASVPLSEWQSKR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGDMLARRTGHGKVDATNSLLALGNPTDLSIEAIRSLRTSLHFAMMEAKNNILMITGASPGIGKTFICSNLATLVAKADQ
                                                       TGASPGIGKTFICSNLATLVAKADQ
                                                              GKT               
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVLLIDGDMRRGYTHQLLGANNKTGLSDVLSGKTEFSSELVQKGAWGFDFLPRGQVPPNPSELLMHNRMNELLHWASMNY
KVLLIDGDMRRGYTHQLLGANNKTGLSDVLSGKTEFSSELVQKGAWGFDFLPRGQVPPNPSELLMHNRMNELLHWASMNY
  LLIDGDMR                                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLVLIDTPPILAVTDASIIGKLAGTSLMVVRFETNTLKEVEFSYRRFMQNGIDIKGVILNAVVRKASNAFGYGYDYYDYS
DLVLIDTPPILAVTDASIIGKLAGTSLMVVRFETNTLKEVEFSYRRFMQNGIDIKGVILNAVVRKASNAFGYGYDYYDYS
  VLIDTPP                                                              YGYDYYDYS
       
....:..
YKQDAKS
YKQDA  
Y      

© 1998-2019