BYKdb

Annotate results for A0A015VNG0

A0A015VNG0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A015VNG0
DOMAINcd500/690TSFNPGSGKSFLTMNMAVSFAIKGKKVLVIDGDLRHGSASSYIDSPAKGLSDYLGGRIDN
LNEIIVADSKHESMDILPVGTIPPNPTELLFDERLKQVIDTVRERYDYVLIDCPPIELVA
DTQIIEKLADRTIFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYG
YRYGYHYGYGY
SITEWalker A507/509GKS
SITEWalker A'527/534LVIDGDLR
SITEWalker B608/614VLIDCPP
SITE-605/-607YDY
SITEY Cluster652/694YEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGYGYHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAEVVKRLNLDMSYFQSGKFHRQVAYGLTLPVTVSMNDFPENESAEFILEVKPDRTVILSDFTRNDETLDSDEIKGILLD


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TIATPLGKIIVEPTLNFNEEKTCLLHVFRNKLYDAINNYSENLSVTLNNEKASVIDLSFKDYSIQRAEDVLSMLISVYNE


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQSSQTNAQILALNNQLYMTRYIRS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQALASMRGAIIKSIDNQIVTLNAQI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSLQQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAYNTRIVTPSHGSMLPTSPVRRNIF


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVAFALGLLIPVVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFARKKKGLFGKKPQEVKAIVVKEGSRDIINEAFRVL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTNLEFMTGKDKRSNVIVVTSFNPGSGKSFLTMNMAVSFAIKGKKVLVIDGDLRHGSASSYIDSPAKGLSDYLGGRIDNL
                   TSFNPGSGKSFLTMNMAVSFAIKGKKVLVIDGDLRHGSASSYIDSPAKGLSDYLGGRIDNL
                          GKS                 LVIDGDLR                          
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NEIIVADSKHESMDILPVGTIPPNPTELLFDERLKQVIDTVRERYDYVLIDCPPIELVADTQIIEKLADRTIFVVRAGLL
NEIIVADSKHESMDILPVGTIPPNPTELLFDERLKQVIDTVRERYDYVLIDCPPIELVADTQIIEKLADRTIFVVRAGLL
                                               VLIDCPP                          
       650       660       670       680       690       700  
....:....|....:....|....:....|....:....|....:....|....:....|..
ERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGYGYHYGSDEKRGG
ERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGY            
           YEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGYGYHY        

© 1998-2019