BYKdb

Annotate results for A0A017RSD4

A0A017RSD4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A017RSD4
DOMAINcd42/230TSTGPGEGKSTTSSNLAVTMAQGGNKTLLIDCDLRKSMLHRKFNLSNEIGLTNLLVDELN
LDRVIQNTRVENLSILTAGTKPPNPAELLGSEKMSSFVQEMKKIYDYIIIDTPPVIMVTD
AQILSQYADGVLLVVASGEAEKDAVLRSKELLQKVDAKILGVVLNKIDASSKGRYNYYYQ
YYYGNDVKN
SITEWalker A49/51GKS
SITEWalker A'69/76LLIDCDLR
SITEWalker B149/155IIIDTPP
SITE-146/-148YDY
SITEY Cluster216/224YNYYYQYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKINLITYNSPKSPITEAYRTLRTNIQFSSFDEKVKVIVITSTGPGEGKSTTSSNLAVTMAQGGNKTLLIDCDLRKSML
                                         TSTGPGEGKSTTSSNLAVTMAQGGNKTLLIDCDLRKSML
                                                GKS                 LLIDCDLR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HRKFNLSNEIGLTNLLVDELNLDRVIQNTRVENLSILTAGTKPPNPAELLGSEKMSSFVQEMKKIYDYIIIDTPPVIMVT
HRKFNLSNEIGLTNLLVDELNLDRVIQNTRVENLSILTAGTKPPNPAELLGSEKMSSFVQEMKKIYDYIIIDTPPVIMVT
                                                                    IIIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAQILSQYADGVLLVVASGEAEKDAVLRSKELLQKVDAKILGVVLNKIDASSKGRYNYYYQYYYGNDVKNIDDKRKNKLL
DAQILSQYADGVLLVVASGEAEKDAVLRSKELLQKVDAKILGVVLNKIDASSKGRYNYYYQYYYGNDVKN          
                                                       YNYYYQYYY                
         
....:....
SIFTNKRSK


© 1998-2019