BYKdb

Annotate results for A0A017RXI2

A0A017RXI2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A017RXI2
DOMAINcd37/224TSSGPTEGKSTTAGNLAISMAEMGKKVLLIDCDLRRPSIHKKFKISNQEGLSNLLVENAK
VEDVAVKFMDNLLILTSGKIPPNPAEMLSSNKMRNFISEMKEEFDFIILDTPPVIAVTDA
QILSTMADGVLLVVSSGQAEREAVERSKTLLVNVGANILGVVLNKVEINSRRGYGYYYYY
GNEKEGNK
SITEWalker A44/46GKS
SITEWalker A'64/71LLIDCDLR
SITEWalker B143/149IILDTPP
SITEY Cluster210/216YGYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIMHRKPKSPVAEAYRTLRTNIQFASFDKDIKTVVVTSSGPTEGKSTTAGNLAISMAEMGKKVLLIDCDLRRPSIHKKFK
                                    TSSGPTEGKSTTAGNLAISMAEMGKKVLLIDCDLRRPSIHKKFK
                                           GKS                 LLIDCDLR         
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISNQEGLSNLLVENAKVEDVAVKFMDNLLILTSGKIPPNPAEMLSSNKMRNFISEMKEEFDFIILDTPPVIAVTDAQILS
ISNQEGLSNLLVENAKVEDVAVKFMDNLLILTSGKIPPNPAEMLSSNKMRNFISEMKEEFDFIILDTPPVIAVTDAQILS
                                                              IILDTPP           
       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
TMADGVLLVVSSGQAEREAVERSKTLLVNVGANILGVVLNKVEINSRRGYGYYYYYGNEKEGNKVK
TMADGVLLVVSSGQAEREAVERSKTLLVNVGANILGVVLNKVEINSRRGYGYYYYYGNEKEGNK  
                                                 YGYYYYY          
© 1998-2019