BYKdb

Annotate results for A0A017T1W1

A0A017T1W1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A017T1W1
DOMAINtad2/169PALNIVLAWRTVRKHWVIALVTAVAVFLLVAFYTLGQKKIYQATATIQFDPNPPRPLGRG
VDTVVEMGTGSYWNNREYYETQYKIIQSMRVALAVVRDLNLHNDSAFLENLPPGKPGPSK
AVSPEEAAEVLRERLTVDPVKESRLAIVRFTDADSQRAQRVLSVLVNT
DOMAINcd536/723TSAGPSEGKTTVVCCIATAMAQAEQRVVMVDCDLRRPRLHRVFGKSTNVGVTTALLEGKL
PDEELMRTEVPNLWVLPAGPLPPNPAELFHSERFKVLLEQLTARYDRVIIDSPPIVAVTD
AAILSTLAEGTVLVTRAFKTQRELARHGVRSLLDVGGKAAGVVLNAVDLDRDEYRYYHYY
SYKKEGFY
SITE-579/-581GKS
SITEWalker A'563/570VMVDCDLR
SITEWalker B643/649VIIDSPP
SITEY Cluster709/723YRYYHYYSYKKEGFY
SITEWalker A543/545GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPALNIVLAWRTVRKHWVIALVTAVAVFLLVAFYTLGQKKIYQATATIQFDPNPPRPLGRGVDTVVEMGTGSYWNNREYY
 PALNIVLAWRTVRKHWVIALVTAVAVFLLVAFYTLGQKKIYQATATIQFDPNPPRPLGRGVDTVVEMGTGSYWNNREYY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETQYKIIQSMRVALAVVRDLNLHNDSAFLENLPPGKPGPSKAVSPEEAAEVLRERLTVDPVKESRLAIVRFTDADSQRAQ
ETQYKIIQSMRVALAVVRDLNLHNDSAFLENLPPGKPGPSKAVSPEEAAEVLRERLTVDPVKESRLAIVRFTDADSQRAQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVLSVLVNTYVEQNLDDVLTSTDSAVEWLRTQLDKLKGDLESSEMALHDYKIDKNILSVAIDDQSNMLREEMKQLNEALT
RVLSVLVNT                                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATRAKREEVRARRDELAKMKASEPADLPSSELLQSHTLQGLRERHDEVVREYKALLGEGKGARHPDVRAAEERVTAAKAA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LMAEVKNIRGALERDVDVVSRQEAGLAALFERAQKQAFELNLLEIEYNRLRRSKDNNEKLYALVLERTKEADLTRMMRVS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NIRVPDPPLAQKKPVRPRVPMNLAAGLLAGVGLGVAAALGRAMLDRTLKTPDDVEQELGLPFLGLLPEISPEERQAGKRA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERRGGRPRRGARGGAGSRELIVHEQPFSGAAEAARAVRTNLLFMAPDNPYRVLLITSAGPSEGKTTVVCCIATAMAQAEQ
                                                       TSAGPSEGKTTVVCCIATAMAQAEQ
                                                              GKT               
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVVMVDCDLRRPRLHRVFGKSTNVGVTTALLEGKLPDEELMRTEVPNLWVLPAGPLPPNPAELFHSERFKVLLEQLTARY
RVVMVDCDLRRPRLHRVFGKSTNVGVTTALLEGKLPDEELMRTEVPNLWVLPAGPLPPNPAELFHSERFKVLLEQLTARY
  VMVDCDLR                                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRVIIDSPPIVAVTDAAILSTLAEGTVLVTRAFKTQRELARHGVRSLLDVGGKAAGVVLNAVDLDRDEYRYYHYYSYKKE
DRVIIDSPPIVAVTDAAILSTLAEGTVLVTRAFKTQRELARHGVRSLLDVGGKAAGVVLNAVDLDRDEYRYYHYYSYKKE
  VIIDSPP                                                           YRYYHYYSYKKE
       730       740     
....:....|....:....|....:
GFYGQDDPRADAPADERPGDSAAAS
GFY                      
GFY                      

© 1998-2019