BYKdb

Annotate results for A0A021VVD9

A0A021VVD9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A021VVD9
DOMAINtad1/135MEFQDYVAILRKRWVSILVVALAVVAAALAATLAATPSYQARSQVYVSVRSGGTTADLVQ
GSNYTQRQVKSYSDLVTSPLVLAPVIEELGLDTRAEVLALAVTATPVVDTSLINISVTDE
DPGRAAAVADALAAS
DOMAINcd267/455TSSLPEEGKSTTAANLALTLADSGARVILVDADLRRPSVANYMGLEGTAGLTTVLIGRAS
LEDVVQPWGAGHLHVLTSGQIPPNPSELLGSQAMAHLLGQLVQRYDHVIIDTPPLLPVTD
AAVLARLTGGAIVVVGAHKVHRHQLEEGIRSLETVNARVLGIVLNRVARKQSETYAYDYS
SDPSQTPRS
SITEWalker A274/276GKS
SITEWalker A'294/301ILVDADLR
SITEWalker B374/380VIIDTPP
SITEY Cluster441/445YAYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEFQDYVAILRKRWVSILVVALAVVAAALAATLAATPSYQARSQVYVSVRSGGTTADLVQGSNYTQRQVKSYSDLVTSPL
MEFQDYVAILRKRWVSILVVALAVVAAALAATLAATPSYQARSQVYVSVRSGGTTADLVQGSNYTQRQVKSYSDLVTSPL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLAPVIEELGLDTRAEVLALAVTATPVVDTSLINISVTDEDPGRAAAVADALAASLAVQVNELEPPTADGQSPVLISTVR
VLAPVIEELGLDTRAEVLALAVTATPVVDTSLINISVTDEDPGRAAAVADALAAS                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAVEPSAPASPSPTRNLALGLLLGLAAGFGVAVLREMLDTKVRDEDHVAQVTESAVIAAIPHDDSAVNDHLIVQSNPMSL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAESFRRLRTNLQFLSAEEQPRALIVTSSLPEEGKSTTAANLALTLADSGARVILVDADLRRPSVANYMGLEGTAGLTTV
                          TSSLPEEGKSTTAANLALTLADSGARVILVDADLRRPSVANYMGLEGTAGLTTV
                                 GKS                 ILVDADLR                   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIGRASLEDVVQPWGAGHLHVLTSGQIPPNPSELLGSQAMAHLLGQLVQRYDHVIIDTPPLLPVTDAAVLARLTGGAIVV
LIGRASLEDVVQPWGAGHLHVLTSGQIPPNPSELLGSQAMAHLLGQLVQRYDHVIIDTPPLLPVTDAAVLARLTGGAIVV
                                                     VIIDTPP                    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGAHKVHRHQLEEGIRSLETVNARVLGIVLNRVARKQSETYAYDYSSDPSQTPRSVSERRSDAPPPPRRSTKAASAEGLD
VGAHKVHRHQLEEGIRSLETVNARVLGIVLNRVARKQSETYAYDYSSDPSQTPRS                         
                                        YAYDY                                   
       490       500       510       520    
....:....|....:....|....:....|....:....|....
LTGTRLPAQGVAGLDAALGGRGGNRWPGEPLGEPSDQAPRHSRA


© 1998-2019