BYKdb

Annotate results for A0A022KTD5

A0A022KTD5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A022KTD5
DOMAINtad1/132MTIEDFLRLLLRNALLLVLLTVLGAAAGYGFSYTKAPVYQASALGFVRGAAGSDPVNSTQ
GQYSKAQFFLPLFQTRAVGQTIVDELGLEASPDAVAGSLGTTLDPNAPIITVTARASSPE
EASAIANASIEA
DOMAINcd260/451TSSAPAEGKSVVSGNLSRVIAGTGQPTLLIDADLRRPLVAKQFGLDGSVGLSQLLAGAVS
VEDVVQPIPGTRLSVLPAGQIPPNPSELLGSRRMHELIKELSRTHFVVIDAPPVLAVTDA
QLLSRHADGAVLVAVTGRTRVEGLRRAIDSIHNVSGKVFGVVLNRASTSRLKRIAYGDAE
YGYSAYGYGSKR
SITEWalker A267/269GKS
SITEWalker A'287/294LLIDADLR
SITEWalker B366/372VVIDAPP
SITEY Cluster435/454YGDAEYGYSAYGYGSKRYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTIEDFLRLLLRNALLLVLLTVLGAAAGYGFSYTKAPVYQASALGFVRGAAGSDPVNSTQGQYSKAQFFLPLFQTRAVGQ
MTIEDFLRLLLRNALLLVLLTVLGAAAGYGFSYTKAPVYQASALGFVRGAAGSDPVNSTQGQYSKAQFFLPLFQTRAVGQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TIVDELGLEASPDAVAGSLGTTLDPNAPIITVTARASSPEEASAIANASIEAVAAEAEKLEPGTGSQLVPYQTALTPGAP
TIVDELGLEASPDAVAGSLGTTLDPNAPIITVTARASSPEEASAIANASIEA                            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSPDRIRYAAVGAAAGLLAAMALAVLRNRNDSRLRTVDQLADEVNVPVLGVLPDVKDFSRPKSGILPEPKTFQAREALRK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FRTNLRFVDVDNPPRSIVVTSSAPAEGKSVVSGNLSRVIAGTGQPTLLIDADLRRPLVAKQFGLDGSVGLSQLLAGAVSV
                   TSSAPAEGKSVVSGNLSRVIAGTGQPTLLIDADLRRPLVAKQFGLDGSVGLSQLLAGAVSV
                          GKS                 LLIDADLR                          
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EDVVQPIPGTRLSVLPAGQIPPNPSELLGSRRMHELIKELSRTHFVVIDAPPVLAVTDAQLLSRHADGAVLVAVTGRTRV
EDVVQPIPGTRLSVLPAGQIPPNPSELLGSRRMHELIKELSRTHFVVIDAPPVLAVTDAQLLSRHADGAVLVAVTGRTRV
                                             VVIDAPP                            
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGLRRAIDSIHNVSGKVFGVVLNRASTSRLKRIAYGDAEYGYSAYGYGSKRYAYGSAAGLETGPEAELEVPDDVISAPVP
EGLRRAIDSIHNVSGKVFGVVLNRASTSRLKRIAYGDAEYGYSAYGYGSKR                             
                                  YGDAEYGYSAYGYGSKRYAY                          
       490       500       510  
....:....|....:....|....:....|..
ETLAADEDPATEHGHRARGGKRAAAPDEDGRK


© 1998-2019