BYKdb

Annotate results for A0A022KX11

A0A022KX11 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A022KX11
DOMAINcd130/316TSAVPGEGKTTTAVNLALAMADSGRRTLLVDADLRNPSVAKTLGMEGSVGLTTLLLGDAD
LDDVIQTWGSAGMDVLPAGPIPPNPSELLGSAPMEALLTRLMQEYDFVLIDSPPVVPVID
AVVIERLTGGLLMVVGVDRTKKRDLAAALKQLETVGAHVSGFARNFVASKGSDYRYGYHR
YEEEMTR
SITEWalker A137/139GKT
SITEWalker A'157/164LLVDADLR
SITEWalker B237/243VLIDSPP
SITEY Cluster303/310YRYGYHRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAGEFSTLLKSSGQKVVSTPIQPASAPAQPVSPNPTRNLALGLLAGLVLGLGLAFIRHALDTKVRGEEDIRAHSDAPMLA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLPLESRGSKRGLISVEEDPHGRHAEAVRRLRTNLMFVDVTTGRHSFVITSAVPGEGKTTTAVNLALAMADSGRRTLLVD
                                                 TSAVPGEGKTTTAVNLALAMADSGRRTLLVD
                                                        GKT                 LLVD
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLRNPSVAKTLGMEGSVGLTTLLLGDADLDDVIQTWGSAGMDVLPAGPIPPNPSELLGSAPMEALLTRLMQEYDFVLID
ADLRNPSVAKTLGMEGSVGLTTLLLGDADLDDVIQTWGSAGMDVLPAGPIPPNPSELLGSAPMEALLTRLMQEYDFVLID
ADLR                                                                        VLID
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPPVVPVIDAVVIERLTGGLLMVVGVDRTKKRDLAAALKQLETVGAHVSGFARNFVASKGSDYRYGYHRYEEEMTRRARK
SPPVVPVIDAVVIERLTGGLLMVVGVDRTKKRDLAAALKQLETVGAHVSGFARNFVASKGSDYRYGYHRYEEEMTR    
SPP                                                           YRYGYHRY          
       330    
....:....|....
AARTEPRAKQRARG


© 1998-2019