BYKdb

Annotate results for A0A022LGD7

A0A022LGD7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A022LGD7
DOMAINtad1/134MTLAQFIDVLRHRWISIAAVLLLATGLAAAFSAVQAPQYRATSEVFVSVAGGASVTDLSQ
GNTFSAARVKSYEELAVTPQVLGQAAKQLGLPGGGGLGRVVTAESKRDTVLISISATDES
PTQAAAIANAVTEQ
DOMAINcd266/458TSATPGEGKSSTAVNLALMLAQNGSRVVLVDADLRRPTTGTYLGIESRVGLSTVLTRQVA
LDDATQQVGADTPLHVLAAGRVPPNPSELLSSSRMVDLVRELESRYEYVIVDAPPMLPVT
DPAVLGAICSGVLLVVSVDGRTRRADFTAAERTVTQVGARLLGLVVNRLPVQRRAKTYYN
YEPSAPVSESPRR
SITEWalker A273/275GKS
SITEWalker A'293/300VLVDADLR
SITEWalker B374/380VIVDAPP
SITE-371/-373YEY
SITEY Cluster443/446YYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLAQFIDVLRHRWISIAAVLLLATGLAAAFSAVQAPQYRATSEVFVSVAGGASVTDLSQGNTFSAARVKSYEELAVTPQ
MTLAQFIDVLRHRWISIAAVLLLATGLAAAFSAVQAPQYRATSEVFVSVAGGASVTDLSQGNTFSAARVKSYEELAVTPQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLGQAAKQLGLPGGGGLGRVVTAESKRDTVLISISATDESPTQAAAIANAVTEQLVKVVDQVENEGAATDGLVHLSVFQP
VLGQAAKQLGLPGGGGLGRVVTAESKRDTVLISISATDESPTQAAAIANAVTEQ                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATAPSTPFSPRLAVNIAIGVLAGLALGIAQAVLREVLDTRLRSFEALRRLTHASVLGEFAMDETIAKEPLVSFDNRYSTR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEAFRQLRTHLTYTNLDGDAQSIVVTSATPGEGKSSTAVNLALMLAQNGSRVVLVDADLRRPTTGTYLGIESRVGLSTVL
                         TSATPGEGKSSTAVNLALMLAQNGSRVVLVDADLRRPTTGTYLGIESRVGLSTVL
                                GKS                 VLVDADLR                    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRQVALDDATQQVGADTPLHVLAAGRVPPNPSELLSSSRMVDLVRELESRYEYVIVDAPPMLPVTDPAVLGAICSGVLLV
TRQVALDDATQQVGADTPLHVLAAGRVPPNPSELLSSSRMVDLVRELESRYEYVIVDAPPMLPVTDPAVLGAICSGVLLV
                                                     VIVDAPP                    
       410       420       430       440       450       460         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
VSVDGRTRRADFTAAERTVTQVGARLLGLVVNRLPVQRRAKTYYNYEPSAPVSESPRRSSRARRTPEDH
VSVDGRTRRADFTAAERTVTQVGARLLGLVVNRLPVQRRAKTYYNYEPSAPVSESPRR           
                                          YYNY                       
© 1998-2019