BYKdb

Annotate results for A0A023NQH6

A0A023NQH6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A023NQH6
DOMAINtad13/269GEIDLSEVVGTVKDHKWTILGITCFFVLLAIAYALVATPVYQATAMVQVEQQVQNLPQLS
ALSQTLAGASPEATTETNLITSRMVIGAAVDKLNLTVETSPRRFPVIGSFYAHRFAKNNP
GKVASPLLGMSDYDWGGSKLEVFRLEVPDDLLDKPLRFIAGEGGLYVLQDDDGNILVIGR
VGQEAKAHGVTIDVKSLAANPGTRFRVFKRRELTVINGLQRQINVTEQGKESGILGMTYN
NASPVMATSVLEQVAEL
DOMAINcd546/733SGASPGAGKTFVSANLAAVVAQTGQRVLLIDGDMRIGVVHKILGGRAEIGLSELISGQVD
MAGAIRQAESPSTLHYITRGKIPPNPSELLMNARFSALLDHLKPKYDLIIIDTPPILAAT
DAAVIGHHSGTGLLVARFGLSQTRELALAKQRFEQNGVSIKGAIFNAVEKRSRGYYAYAY
YSVEKAVS
SITEWalker A553/555GKT
SITEWalker A'573/580LLIDGDMR
SITEWalker B654/660IIIDTPP
SITEY Cluster720/726YYAYAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTIIQYPSMQPDGEIDLSEVVGTVKDHKWTILGITCFFVLLAIAYALVATPVYQATAMVQVEQQVQNLPQLSALSQTLAG
            GEIDLSEVVGTVKDHKWTILGITCFFVLLAIAYALVATPVYQATAMVQVEQQVQNLPQLSALSQTLAG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASPEATTETNLITSRMVIGAAVDKLNLTVETSPRRFPVIGSFYAHRFAKNNPGKVASPLLGMSDYDWGGSKLEVFRLEVP
ASPEATTETNLITSRMVIGAAVDKLNLTVETSPRRFPVIGSFYAHRFAKNNPGKVASPLLGMSDYDWGGSKLEVFRLEVP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDLLDKPLRFIAGEGGLYVLQDDDGNILVIGRVGQEAKAHGVTIDVKSLAANPGTRFRVFKRRELTVINGLQRQINVTEQ
DDLLDKPLRFIAGEGGLYVLQDDDGNILVIGRVGQEAKAHGVTIDVKSLAANPGTRFRVFKRRELTVINGLQRQINVTEQ

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKESGILGMTYNNASPVMATSVLEQVAELYVRQNVERNSAEAANSLKFVRDQIPNVRHELERATAALNEFQNKAQSVDIN
GKESGILGMTYNNASPVMATSVLEQVAEL                                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQTQTLLNQSVSIDTNLEQLRLQLADVQRQFTPAHPQYQALMKQIGQLQAQKGAIEKKVGGLPDTQQQLLKLTRDVQVSN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETYTSLLNQAQQLDIARAGTIGNVRIIDRAAVDVTQPVWPRTTLILMGSALFGGFVALLYVFIRQMLNRGIEDPAVIEKL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLPVYATIPVSPRERALQSKRMRPDGREHVLVEDSPKDLAAEALRSLRTSLHFARLEAKNNVLMISGASPGAGKTFVSAN
                                                                 SGASPGAGKTFVSAN
                                                                        GKT     
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAAVVAQTGQRVLLIDGDMRIGVVHKILGGRAEIGLSELISGQVDMAGAIRQAESPSTLHYITRGKIPPNPSELLMNARF
LAAVVAQTGQRVLLIDGDMRIGVVHKILGGRAEIGLSELISGQVDMAGAIRQAESPSTLHYITRGKIPPNPSELLMNARF
            LLIDGDMR                                                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SALLDHLKPKYDLIIIDTPPILAATDAAVIGHHSGTGLLVARFGLSQTRELALAKQRFEQNGVSIKGAIFNAVEKRSRGY
SALLDHLKPKYDLIIIDTPPILAATDAAVIGHHSGTGLLVARFGLSQTRELALAKQRFEQNGVSIKGAIFNAVEKRSRGY
             IIIDTPP                                                           Y
       730   
....:....|...
YAYAYYSVEKAVS
YAYAYYSVEKAVS
YAYAYY       

© 1998-2019