BYKdb

Annotate results for A0A023X491

A0A023X491 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A023X491
DOMAINcd56/242TSPGQQEGKSTTCANLAVTLAQAEKSVLLLDCDLRKPVVHSIFELRNTRGVVDALVGSEN
VEELWQTPLDNLSVLTSGPVPPNPAELLGSERFGALLGDLARRFEYVLIDVPPVQVVSDA
AIVAAQADGVILVFDAQSTRKLSVRRSIRTIESVGAKVLGTVMNNARPARNGTYGGYTYS
YGEAAGS
SITEWalker A63/65GKS
SITEWalker A'83/90LLLDCDLR
SITEWalker B162/168VLIDVPP
SITEY Cluster229/236YGGYTYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARSKPLKKHKKTENLTDRLVSLSDPGGQAAEAYRTLRTSLLYSVVDEPPHVVAVTSPGQQEGKSTTCANLAVTLAQAEK
                                                       TSPGQQEGKSTTCANLAVTLAQAEK
                                                              GKS               
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVLLLDCDLRKPVVHSIFELRNTRGVVDALVGSENVEELWQTPLDNLSVLTSGPVPPNPAELLGSERFGALLGDLARRFE
SVLLLDCDLRKPVVHSIFELRNTRGVVDALVGSENVEELWQTPLDNLSVLTSGPVPPNPAELLGSERFGALLGDLARRFE
  LLLDCDLR                                                                      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YVLIDVPPVQVVSDAAIVAAQADGVILVFDAQSTRKLSVRRSIRTIESVGAKVLGTVMNNARPARNGTYGGYTYSYGEAA
YVLIDVPPVQVVSDAAIVAAQADGVILVFDAQSTRKLSVRRSIRTIESVGAKVLGTVMNNARPARNGTYGGYTYSYGEAA
 VLIDVPP                                                            YGGYTYSY    
  
..
GS
GS

© 1998-2019