BYKdb

Annotate results for A0A024IWS2

A0A024IWS2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A024IWS2
DOMAINtad21/205DFIDIDAALAMIRRQWRIVLAAIVVAGAIGLAFAATAVPIYSATATLLIDRNNSQIVEQL
STIGGVIEDEASILSQVEVLQSETIGLAVVDSLNLTENQEFRATRASLLSSIFSTVRSLV
NVSQWFSPVKKETVIDDGTLKRSLSDRLLQGLSVKRIGRTYALELTYNSTSPVLAAQIVN
AVASA
DOMAINcd565/755VSALPSEGKSTISINLAQLLAGQGARVLLLDADIRNPGATRALARHATEGLLEVLLEGRN
IRDVLLHDEKTRLAFLPTVVKQRVPHSSELLTSPQMHKLLAEAGSVFDYIIVDLPPLGPV
VDARAMASRIDGFVFVTEWGKTARRAVRNTIENEVHIRKKCLGVILNKVDTEKLKLYRAY
GSSEYYHSRYT
SITE-704/-706GKT
SITEWalker A'592/599LLLDADIR
SITEWalker B674/680IIVDLPP
SITEY Cluster741/758YRAYGSSEYYHSRYTRYY
SITEWalker A572/574GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQRHDPLTMTDYDKSGLTADFIDIDAALAMIRRQWRIVLAAIVVAGAIGLAFAATAVPIYSATATLLIDRNNSQIVEQL
                    DFIDIDAALAMIRRQWRIVLAAIVVAGAIGLAFAATAVPIYSATATLLIDRNNSQIVEQL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STIGGVIEDEASILSQVEVLQSETIGLAVVDSLNLTENQEFRATRASLLSSIFSTVRSLVNVSQWFSPVKKETVIDDGTL
STIGGVIEDEASILSQVEVLQSETIGLAVVDSLNLTENQEFRATRASLLSSIFSTVRSLVNVSQWFSPVKKETVIDDGTL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRSLSDRLLQGLSVKRIGRTYALELTYNSTSPVLAAQIVNAVASAYLVDKLNSKYEATKRASDWLSDRIAELRQRALETD
KRSLSDRLLQGLSVKRIGRTYALELTYNSTSPVLAAQIVNAVASA                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAVQKFRAEHNLIETGTSGLLSDQQLAASNSALILAQSDTARARARVQRIEYILATDDVDAVVTDILDSAVANDLRKKYL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESSKLEAEITSRLGSNHVQAVRLRNEMQEYRRLMFQEISRIAQSYKSDLEVSEAREKSLAESVAKATNVSTSASQTQVQL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RELQREAETYKNMYQTFLQRYQEAMQQQSFPVTEARVISKAMPPYTPSKPNKTMILALFMIMGAAAGGGIAVFREFRDRF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FRTGEQVRDVLGLEFLGNTPLVQGKPGADTLKDQGDASSATRPSSVARYAVDHPLSSFAETLRSTRLAMDLGIASKHGAR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVGVVSALPSEGKSTISINLAQLLAGQGARVLLLDADIRNPGATRALARHATEGLLEVLLEGRNIRDVLLHDEKTRLAFL
    VSALPSEGKSTISINLAQLLAGQGARVLLLDADIRNPGATRALARHATEGLLEVLLEGRNIRDVLLHDEKTRLAFL
           GKS                 LLLDADIR                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTVVKQRVPHSSELLTSPQMHKLLAEAGSVFDYIIVDLPPLGPVVDARAMASRIDGFVFVTEWGKTARRAVRNTIENEVH
PTVVKQRVPHSSELLTSPQMHKLLAEAGSVFDYIIVDLPPLGPVVDARAMASRIDGFVFVTEWGKTARRAVRNTIENEVH
                                 IIVDLPP                                        
       730       740       750       760
....:....|....:....|....:....|....:....|
IRKKCLGVILNKVDTEKLKLYRAYGSSEYYHSRYTRYYHD
IRKKCLGVILNKVDTEKLKLYRAYGSSEYYHSRYT     
                    YRAYGSSEYYHSRYTRYY  

© 1998-2019