BYKdb

Annotate results for A0A024KA69

A0A024KA69 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A024KA69
DOMAINcd321/513SSATGGEGKTTLALALARSYGLAGHSVLLIDCDLRNPSIHRYLGLEPSRGLLEYLAEPAE
PRQLKAMMAEDDVSGVRIALGGLGAQDATDELVAGSEFARLIAAAVQSFEFVIIDSPPLG
SVVDGLHLARLADVVTFVMRYRSVPRNAAAQALAALAHTRREQSELVGVLNLGPAPTGSK
AYRAATYVPKLSP
SITEWalker A328/330GKT
SITEWalker A'348/355LLIDCDLR
SITEWalker B432/438VIIDSPP
SITEY Cluster502/507YRAATY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALAVAAGLALASAALLVMPVSYSATALLYFDPSPRGVLEDGRPGAGDGARVDSAVDLIASEPVLASAARALGLAGERAP


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DWLGSRVKVQRDGPTYLVSVRANAPSPIEAASYANAVANSFIHEEVAAKIDGVLADVAALRAQVTVAGEAVRAAQQALGL


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSGFEERQALASAQSHYRMLLDRLTRLEAEAFLQVPSARIAAVASPPVAPSSPKVGLTLALAGGVALIFGLLLAFARERV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPGFVDAEEAGRRLGLEPILTIPRQKLQRGRDGELWLTPADQLAQAPLAEFPEAVRRLRISVDQALQRKSVAHRGAVVMV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSATGGEGKTTLALALARSYGLAGHSVLLIDCDLRNPSIHRYLGLEPSRGLLEYLAEPAEPRQLKAMMAEDDVSGVRIAL
SSATGGEGKTTLALALARSYGLAGHSVLLIDCDLRNPSIHRYLGLEPSRGLLEYLAEPAEPRQLKAMMAEDDVSGVRIAL
       GKT                 LLIDCDLR                                             
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGLGAQDATDELVAGSEFARLIAAAVQSFEFVIIDSPPLGSVVDGLHLARLADVVTFVMRYRSVPRNAAAQALAALAHTR
GGLGAQDATDELVAGSEFARLIAAAVQSFEFVIIDSPPLGSVVDGLHLARLADVVTFVMRYRSVPRNAAAQALAALAHTR
                               VIIDSPP                                          
       490       500       510       520  
....:....|....:....|....:....|....:....|..
REQSELVGVLNLGPAPTGSKAYRAATYVPKLSPSLRQASHWH
REQSELVGVLNLGPAPTGSKAYRAATYVPKLSP         
                     YRAATY               
© 1998-2019