BYKdb

Annotate results for A0A031FRH9

A0A031FRH9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A031FRH9
DOMAINtad5/141APWSGHWLLSALRKFWWGVAVCAVVGATAAFGLSALETPQYQSTSSLYFALNQGASASDL
NQGSAYTQNQMLSIAQLATTSRVLEPVIEELGLDTTPRDLARSLDVSIPQDTVILRVTST
TTNADRAAALSNAVAAE
DOMAINcd273/461TSGSPGEGKSTVAVNLALTLADLNHRVLLIDADLRRPQVHVFFGIEDAVGLTSVLLKMHD
FDTAKYPFRSSTLDVLPSGGTPPNPAEILASQAMADLLEESAARYDFVVVDAPPMLNVAD
ASLLAPSVDGVLFVVDATKTRRPNAAKSIKLLEGAGARILGSILNRARHDKKAGDYYGPV
TPGRAAINP
SITEWalker A280/282GKS
SITEWalker A'300/307LLIDADLR
SITEWalker B380/386VVVDAPP
SITEY Cluster448/449YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAETAPWSGHWLLSALRKFWWGVAVCAVVGATAAFGLSALETPQYQSTSSLYFALNQGASASDLNQGSAYTQNQMLSIAQ
    APWSGHWLLSALRKFWWGVAVCAVVGATAAFGLSALETPQYQSTSSLYFALNQGASASDLNQGSAYTQNQMLSIAQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LATTSRVLEPVIEELGLDTTPRDLARSLDVSIPQDTVILRVTSTTTNADRAAALSNAVAAELADVVLQISPKGAEGAPTI
LATTSRVLEPVIEELGLDTTPRDLARSLDVSIPQDTVILRVTSTTTNADRAAALSNAVAAE                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAETIDKAVAPSSQSSPNKPRDALLGLLIGALLGIAAALIFSAADTRVRNEDILARVSGTPVLGVITRAPLLAHRAAGVA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEPMGRSAEEFRRLRSALTYANVGSRVSTLLVTSGSPGEGKSTVAVNLALTLADLNHRVLLIDADLRRPQVHVFFGIEDA
                                TSGSPGEGKSTVAVNLALTLADLNHRVLLIDADLRRPQVHVFFGIEDA
                                       GKS                 LLIDADLR             
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGLTSVLLKMHDFDTAKYPFRSSTLDVLPSGGTPPNPAEILASQAMADLLEESAARYDFVVVDAPPMLNVADASLLAPSV
VGLTSVLLKMHDFDTAKYPFRSSTLDVLPSGGTPPNPAEILASQAMADLLEESAARYDFVVVDAPPMLNVADASLLAPSV
                                                           VVVDAPP              
       410       420       430       440       450       460       470  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
DGVLFVVDATKTRRPNAAKSIKLLEGAGARILGSILNRARHDKKAGDYYGPVTPGRAAINPAPAATADAARD
DGVLFVVDATKTRRPNAAKSIKLLEGAGARILGSILNRARHDKKAGDYYGPVTPGRAAINP           
                                               YY                       
© 1998-2019