BYKdb

Annotate results for A0A031GRT8

A0A031GRT8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A031GRT8
DOMAINtad1/126MNIIDFLRVLRANRLVILGCAALGLAMGLVYSLLQPTLYTATSSAFVTVEGEASISGTET
AQTRAQSYIPLINSRTVRERIASEGLDTAGATMSAALVPNSNLITVSAVAPDAQQAAALA
NGALVA
DOMAINcd253/438TSSNPGEGKSTVIGNLALTVAAAGQPVILIDADLRRPRQALQFGVDGRVGLSEVLNGDVA
LQDVLIPVGEDGLLLLPAGRTPPNPSEQLGSERMKDLLTALAETHMVLVDAPPVLPVTDS
TLLAAAVDGTVLVIRHGKTRKEHLEVARDMLAGVNARVLGVVLNGTPASGVGSDYYGGGY
GADGGS
SITE-389/-391GKT
SITEWalker A'280/287ILIDADLR
SITEWalker B359/365VLVDAPP
SITEY Cluster427/443YYGGGYGADGGSYDVYY
SITEWalker A260/262GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNIIDFLRVLRANRLVILGCAALGLAMGLVYSLLQPTLYTATSSAFVTVEGEASISGTETAQTRAQSYIPLINSRTVRER
MNIIDFLRVLRANRLVILGCAALGLAMGLVYSLLQPTLYTATSSAFVTVEGEASISGTETAQTRAQSYIPLINSRTVRER

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IASEGLDTAGATMSAALVPNSNLITVSAVAPDAQQAAALANGALVATADVANELDPTSNVKVTAMEDALAPAAPSSPDRV
IASEGLDTAGATMSAALVPNSNLITVSAVAPDAQQAAALANGALVA                                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RHLLYGLGAGLVLGLIVALLRRLLDVNVRTTTDAQVAGGAGLLGAIPLDPSMKAERTAPMAPLSLRASEAVRQLRTNLRF


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAVDDPPRTIAFTSSNPGEGKSTVIGNLALTVAAAGQPVILIDADLRRPRQALQFGVDGRVGLSEVLNGDVALQDVLIPV
            TSSNPGEGKSTVIGNLALTVAAAGQPVILIDADLRRPRQALQFGVDGRVGLSEVLNGDVALQDVLIPV
                   GKS                 ILIDADLR                                 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GEDGLLLLPAGRTPPNPSEQLGSERMKDLLTALAETHMVLVDAPPVLPVTDSTLLAAAVDGTVLVIRHGKTRKEHLEVAR
GEDGLLLLPAGRTPPNPSEQLGSERMKDLLTALAETHMVLVDAPPVLPVTDSTLLAAAVDGTVLVIRHGKTRKEHLEVAR
                                      VLVDAPP                                   
       410       420       430       440       450       460   
....:....|....:....|....:....|....:....|....:....|....:....|...
DMLAGVNARVLGVVLNGTPASGVGSDYYGGGYGADGGSYDVYYQAPRDAAEAATGTTGDASPR
DMLAGVNARVLGVVLNGTPASGVGSDYYGGGYGADGGS                         
                          YYGGGYGADGGSYDVYY                    
© 1998-2019