BYKdb

Annotate results for A0A031GSP3

A0A031GSP3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A031GSP3
DOMAINtad1/135MDLQQYLQTFRKYWRSILTVLSVCVGAALAFTFLQTPKYSSTSSALIAVDTAASPGELSS
GALYAERQVSSFVALADSALVLDPVIDELGLNVTPQALRSRVSVSAPAGTSIVDVTVTDA
DAGRAAEIANAITAS
DOMAINcd270/447TSSVQGEGKTETSTNLAKVLAETGARVLLVDADLRRPQVGARLGLDDELGLSDVLTGRAD
LNDVLLSVDDLSVLTAGTVPPNPSELLGSEAMAELLALVEAHFEYVILDAPPLLPVTDAA
VLSHQAGGAVVVARAGVARQNQLTEALSILEAADASVYGVVLNDVPVSQIDGYSQYYR
SITEWalker A277/279GKT
SITEWalker A'297/304LLVDADLR
SITEWalker B375/381VILDAPP
SITEY Cluster442/446YSQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDLQQYLQTFRKYWRSILTVLSVCVGAALAFTFLQTPKYSSTSSALIAVDTAASPGELSSGALYAERQVSSFVALADSAL
MDLQQYLQTFRKYWRSILTVLSVCVGAALAFTFLQTPKYSSTSSALIAVDTAASPGELSSGALYAERQVSSFVALADSAL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDPVIDELGLNVTPQALRSRVSVSAPAGTSIVDVTVTDADAGRAAEIANAITASLKNVTSDVVPTGPDGDEIVTVTVVE
VLDPVIDELGLNVTPQALRSRVSVSAPAGTSIVDVTVTDADAGRAAEIANAITAS                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAAASSRPVSPRPAVNLALGLIAGVVLGLGQALVRRLLDSRIRTREDLEEITDAPVLASVVRHKGSDQTKDGAAPTRGTA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WASGESYRKLRTAVGFVALGGERRSSIVVTSSVQGEGKTETSTNLAKVLAETGARVLLVDADLRRPQVGARLGLDDELGL
                             TSSVQGEGKTETSTNLAKVLAETGARVLLVDADLRRPQVGARLGLDDELGL
                                    GKT                 LLVDADLR                
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDVLTGRADLNDVLLSVDDLSVLTAGTVPPNPSELLGSEAMAELLALVEAHFEYVILDAPPLLPVTDAAVLSHQAGGAVV
SDVLTGRADLNDVLLSVDDLSVLTAGTVPPNPSELLGSEAMAELLALVEAHFEYVILDAPPLLPVTDAAVLSHQAGGAVV
                                                      VILDAPP                   
       410       420       430       440       
....:....|....:....|....:....|....:....|....:..
VARAGVARQNQLTEALSILEAADASVYGVVLNDVPVSQIDGYSQYYR
VARAGVARQNQLTEALSILEAADASVYGVVLNDVPVSQIDGYSQYYR
                                         YSQYY 
© 1998-2019