BYKdb

Annotate results for A0A031HX56

A0A031HX56 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A031HX56
DOMAINtad25/178RAVTLRSVGDAIRRRWIVVVATAVLVFAAALGAALMLTPKYDAFAKVRITPNAASPLDFG
NTNEQPADQTAVNTEVQVIGSRGTARKVVTQLGLDRDPEFAGKGPANTAIERATSGVLDH
LKINRDDKSYLVMIGIRSVDGAKAARIANTYAAT
DOMAINcd526/714ASTLPGEGKTTSALSLARVMAMSGDRVLLIDCDVRRAGVLRALNRSVDTGLADVLEGRST
MAQAVIPDEVDGLDLLLVQGSLFTPIDLFGGGRMEAMLEAARSRYDFIILDTPPLLGIAD
ARTLVGLADAVMLVIKWNATPIAAVDAALAGLEHSHGEVLGAVLTMVDHRSEAMGGLYYS
ARYSSYYNE
SITEWalker A533/535GKT
SITEWalker A'553/560LLIDCDVR
SITEWalker B633/639IILDTPP
SITEY Cluster703/712YYSARYSSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNKMSALAETEEASRFDQSRHVGRRAVTLRSVGDAIRRRWIVVVATAVLVFAAALGAALMLTPKYDAFAKVRITPNAASP
                        RAVTLRSVGDAIRRRWIVVVATAVLVFAAALGAALMLTPKYDAFAKVRITPNAASP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDFGNTNEQPADQTAVNTEVQVIGSRGTARKVVTQLGLDRDPEFAGKGPANTAIERATSGVLDHLKINRDDKSYLVMIGI
LDFGNTNEQPADQTAVNTEVQVIGSRGTARKVVTQLGLDRDPEFAGKGPANTAIERATSGVLDHLKINRDDKSYLVMIGI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSVDGAKAARIANTYAATYVAGTADNLMGTAAKQSQSIQDRLRELGAEVQAADARLASYRAQSGISQSGEGGTITDQQIA
RSVDGAKAARIANTYAAT                                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLSMQLATAESEAAAARSALSVAERQNATGGTDAISAVLSSGVIADLRRQRTEAEKRRAELSSRYGPRYPLSIQVAEQIE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLDQQIRQEAQRVVGGLRSQALSAEARAASLRGRLNTLQRGVARDDQASVMAGSLERDAEAKRTAYTRLAQAAQQSSQAQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVSTPQANIIENATIPTKPTFPQVKAFAAAGLLIGLVFGLAGVLLFEGLSSTIRKPEDIETLLGLSFVASVPRLPTPWKL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAHRVTNPATTLVAKPMTVYAEAYRAIRAFVVTRNQTQPTKVIALASTLPGEGKTTSALSLARVMAMSGDRVLLIDCDVR
                                             ASTLPGEGKTTSALSLARVMAMSGDRVLLIDCDVR
                                                    GKT                 LLIDCDVR
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAGVLRALNRSVDTGLADVLEGRSTMAQAVIPDEVDGLDLLLVQGSLFTPIDLFGGGRMEAMLEAARSRYDFIILDTPPL
RAGVLRALNRSVDTGLADVLEGRSTMAQAVIPDEVDGLDLLLVQGSLFTPIDLFGGGRMEAMLEAARSRYDFIILDTPPL
                                                                        IILDTPP 
       650       660       670       680       690       700       710    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
LGIADARTLVGLADAVMLVIKWNATPIAAVDAALAGLEHSHGEVLGAVLTMVDHRSEAMGGLYYSARYSSYYNE
LGIADARTLVGLADAVMLVIKWNATPIAAVDAALAGLEHSHGEVLGAVLTMVDHRSEAMGGLYYSARYSSYYNE
                                                              YYSARYSSYY  

© 1998-2019