BYKdb

Annotate results for A0A031IFB9

A0A031IFB9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A031IFB9
DOMAINcd50/231TSATQGEGKSTTSSNLAVTYAQQGKKVLIVDTDMRRPTVHYTFRVANGLGLSSLLTRQAE
KEKAILPTKVDNLSILTAGPIPPNPAELLSSRAMEHLVAQLREEFDVIIFDAPPLLQVAD
SRITSKLTDGVVLVVGCTTSDRQRVLKAKEQLELAEAKILGVVLNRRELTDDSAYQYYYS
YE
SITEWalker A57/59GKS
SITEWalker A'77/84LIVDTDMR
SITEWalker B157/163IIFDAPP
SITEY Cluster224/230YQYYYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKKSKMNKDARKLITVTQPKSPVAEQYRTIRTNIEFMAVDREIQAILVTSATQGEGKSTTSSNLAVTYAQQGKKVLIVD
                                                 TSATQGEGKSTTSSNLAVTYAQQGKKVLIVD
                                                        GKS                 LIVD
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDMRRPTVHYTFRVANGLGLSSLLTRQAEKEKAILPTKVDNLSILTAGPIPPNPAELLSSRAMEHLVAQLREEFDVIIFD
TDMRRPTVHYTFRVANGLGLSSLLTRQAEKEKAILPTKVDNLSILTAGPIPPNPAELLSSRAMEHLVAQLREEFDVIIFD
TDMR                                                                        IIFD
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
APPLLQVADSRITSKLTDGVVLVVGCTTSDRQRVLKAKEQLELAEAKILGVVLNRRELTDDSAYQYYYSYE
APPLLQVADSRITSKLTDGVVLVVGCTTSDRQRVLKAKEQLELAEAKILGVVLNRRELTDDSAYQYYYSYE
APP                                                            YQYYYSY 
© 1998-2019