BYKdb

Annotate results for A0A031J1W8

A0A031J1W8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A031J1W8
DOMAINtad1/155MLIGTILLGTIVAGVVLTLLITPKYKANAQVLIEDQADQIIEGSELQKVDAGWDTNRFLQ
TQLGIIRSRSLARIVIQSGGFDKKPEFFEALGTTMPDDDKLKGPQLATARQDTAVNVLLE
NLEVDLPRDSRIATITVTSRDSELAARIANLYADR
DOMAINcd499/689TSSREGEGKSTTARTIARDIAGIGKRVLLVDMDLRRPTLHRKLEMTGASGLTDLLTGNKS
FDDVLLRSEIDNLDFITGLPTPPDPALILSGEGVPAFLTQARERYDVVIIDSPPLLGLSD
AVILATHADGVLFVIDGSAFHRGAVKSALRRLALINANILGVVLNRFEPRVGDDQYAYYA
YNYYNYGSDGK
SITEWalker A506/508GKS
SITEWalker A'526/533LLVDMDLR
SITEWalker B606/612VIIDSPP
SITEY Cluster674/684YAYYAYNYYNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLIGTILLGTIVAGVVLTLLITPKYKANAQVLIEDQADQIIEGSELQKVDAGWDTNRFLQTQLGIIRSRSLARIVIQSGG
MLIGTILLGTIVAGVVLTLLITPKYKANAQVLIEDQADQIIEGSELQKVDAGWDTNRFLQTQLGIIRSRSLARIVIQSGG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDKKPEFFEALGTTMPDDDKLKGPQLATARQDTAVNVLLENLEVDLPRDSRIATITVTSRDSELAARIANLYADRFIEYN
FDKKPEFFEALGTTMPDDDKLKGPQLATARQDTAVNVLLENLEVDLPRDSRIATITVTSRDSELAARIANLYADR     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNQKYQSSAYARRFLGDQLSEARAKLTQSERDLNQYARAAGLIRVSSQGDSGTQETALSVTNNTLIQLNDAASKAVAERI


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAEDRWNTLARQPALSVPEVNANQAIQQLVGEKTKIEGQLAEEQSRHLDDYSTVKSKRAQIAELNRRILTLAETLKKTAY


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDYVTALEREKSLTAQVNTLRNAALGEQDRGVQYSVLKREADTNRALYETLLSRYNQISAMAGASNNNLTIVDRAEVPRI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PASPKLAVNLVVSFILGLMFAAAAVFMREIFDDAIRTPDDVERKLNMRLLGLIPKVKDGEDIDEAITDHRSGASEAYRSL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTNLRYSTATGVPQILCVTSSREGEGKSTTARTIARDIAGIGKRVLLVDMDLRRPTLHRKLEMTGASGLTDLLTGNKSFD
                  TSSREGEGKSTTARTIARDIAGIGKRVLLVDMDLRRPTLHRKLEMTGASGLTDLLTGNKSFD
                         GKS                 LLVDMDLR                           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVLLRSEIDNLDFITGLPTPPDPALILSGEGVPAFLTQARERYDVVIIDSPPLLGLSDAVILATHADGVLFVIDGSAFHR
DVLLRSEIDNLDFITGLPTPPDPALILSGEGVPAFLTQARERYDVVIIDSPPLLGLSDAVILATHADGVLFVIDGSAFHR
                                             VIIDSPP                            
       650       660       670       680         
....:....|....:....|....:....|....:....|....:....
GAVKSALRRLALINANILGVVLNRFEPRVGDDQYAYYAYNYYNYGSDGK
GAVKSALRRLALINANILGVVLNRFEPRVGDDQYAYYAYNYYNYGSDGK
                                 YAYYAYNYYNY     
© 1998-2019