BYKdb

Annotate results for A0A031J7F7

A0A031J7F7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A031J7F7
DOMAINtad24/183IDIDFPAIWNLLRRNVHLIGGVVAIALLIGVVIVMRAERLYRATATVQIEEQSAKVLNSE
DGRQASGSQEAERFLQTQLSLLNSRAMAQLVVKKLNLASRIPPGPDGRILSPQEREEAAI
AKLQSSMSLTLPRDSRVAQITITDRDPRFVADAANAYAEE
DOMAINcd523/698TSSRSSEGKSTCAYAVALNFARSGRRVLFIDADLRRPTLHRAIGLPNDKGLASVLAGETT
LNDAIRYGVADRLDVLTGGQPTRNPAELLAQPVLASIIAAAEQSYDLVVIDSAPVLLLAD
AIALASAAGATVFVVEANGARAREARAAVQRLDENGARLCGAVLTKYDRELMQYRY
SITEWalker A530/532GKS
SITEWalker A'550/557LFIDADLR
SITEWalker B630/636VVIDSAP
SITEY Cluster696/698YRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MATIAPNQITQRPRRDDDGGSEGIDIDFPAIWNLLRRNVHLIGGVVAIALLIGVVIVMRAERLYRATATVQIEEQSAKVL
                       IDIDFPAIWNLLRRNVHLIGGVVAIALLIGVVIVMRAERLYRATATVQIEEQSAKVL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSEDGRQASGSQEAERFLQTQLSLLNSRAMAQLVVKKLNLASRIPPGPDGRILSPQEREEAAIAKLQSSMSLTLPRDSRV
NSEDGRQASGSQEAERFLQTQLSLLNSRAMAQLVVKKLNLASRIPPGPDGRILSPQEREEAAIAKLQSSMSLTLPRDSRV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQITITDRDPRFVADAANAYAEEFIQYNLGRRFGETSYARTFLENELGKAKKRLEASEVAVVDYARRTRLIDATGGKGTE
AQITITDRDPRFVADAANAYAEE                                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGVRMLTSSNLMDINSALGRAKVERIEAERRWRQAQATPALNMPEVMTNPAVQQLVEKRALSTADYSRDREKFREDYPGM


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDRATELTALNNEVQKIAQTIRGGLRNNYEIAVNQERALASQLESLKTRTVEEQNKSIGYNILRREVDTNRLMYDGLLQR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FKEVSAAAGVTANNISIVDRAEVPNRPFTPRTTMTLLSSLASGFALALVLVGVRSRLDDIIRSPEDVASALDLPVLATIP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SHPSRLSMTEVIEGSSLSEAFWSLRLAVERTSSGGVPRSLLFTSSRSSEGKSTCAYAVALNFARSGRRVLFIDADLRRPT
                                          TSSRSSEGKSTCAYAVALNFARSGRRVLFIDADLRRPT
                                                 GKS                 LFIDADLR   
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LHRAIGLPNDKGLASVLAGETTLNDAIRYGVADRLDVLTGGQPTRNPAELLAQPVLASIIAAAEQSYDLVVIDSAPVLLL
LHRAIGLPNDKGLASVLAGETTLNDAIRYGVADRLDVLTGGQPTRNPAELLAQPVLASIIAAAEQSYDLVVIDSAPVLLL
                                                                     VVIDSAP    
       650       660       670       680       690        
....:....|....:....|....:....|....:....|....:....|....:...
ADAIALASAAGATVFVVEANGARAREARAAVQRLDENGARLCGAVLTKYDRELMQYRY
ADAIALASAAGATVFVVEANGARAREARAAVQRLDENGARLCGAVLTKYDRELMQYRY
                                                       YRY
© 1998-2019