BYKdb

Annotate results for A0A031JAH8

A0A031JAH8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A031JAH8
DOMAINtad17/171QMIDLRHIVMTIRRRKLWIAATILMVILLTIIAYITAERRYSATASLALDRRVDEIVAQQ
DQPLSTDSSSVDTEVQVLTSPRLVEEVVDKLKLASRPEFADGPATTPVQARKRTVKKVLN
NLDATREGTSYAIAVTYTSPDRHLAANVVNTVVDQ
DOMAINcd514/702SSALPGEGKTTLSISLARSAALAGQRVLLIDCDLRRRASSKSMTSSVENGLIEVLKGDVQ
LDEALHRDTSTNVWILPQTEAGSTNYDLVASPAMGALLDQVRPAFDLIILDTAPVLPLAE
ARALASIADGVLLVVRWRTTPVQAAQMAIDLLGRSGARILGVAMTIVNMKQHARSGYGDE
MAYYHRFKE
SITEWalker A521/523GKT
SITEWalker A'541/548LLIDCDLR
SITEWalker B621/627IILDTAP
SITEY Cluster690/704YGDEMAYYHRFKEYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSFTKMGLEGREEDRAQMIDLRHIVMTIRRRKLWIAATILMVILLTIIAYITAERRYSATASLALDRRVDEIVAQQDQPL
                QMIDLRHIVMTIRRRKLWIAATILMVILLTIIAYITAERRYSATASLALDRRVDEIVAQQDQPL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STDSSSVDTEVQVLTSPRLVEEVVDKLKLASRPEFADGPATTPVQARKRTVKKVLNNLDATREGTSYAIAVTYTSPDRHL
STDSSSVDTEVQVLTSPRLVEEVVDKLKLASRPEFADGPATTPVQARKRTVKKVLNNLDATREGTSYAIAVTYTSPDRHL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AANVVNTVVDQYIEDKLLGRSDERSREVSLLRSRLASLRNEVIRSEAAVARYRAATNLIDVQKDSTSVQQEISALNGQLA
AANVVNTVVDQ                                                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAQAEAAAAQARLGAMRANGAGSTDAASSTLLRDLRSQQATLGVQRADLAGRYGTLHPDLARIDRQLADIDRSIEQETRR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
INASAAEDARVAQGRASSIRSSLNQATAGLRAGNSATVQLNELERSAESARTLYQTLLDRYNKAITGQGTDRSNAYVIAH


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AMTPGSPVSPNLPIYIAGGVIAAVFAAAGLVIVLELLENGFQSRGDIEAQLGVPVVGTVPDLATMPNVTLPKGDPMGPPD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLVANEGSFYSEAFRSIRTALQLGQSQHRVLSVSSALPGEGKTTLSISLARSAALAGQRVLLIDCDLRRRASSKSMTSSV
                                 SSALPGEGKTTLSISLARSAALAGQRVLLIDCDLRRRASSKSMTSSV
                                        GKT                 LLIDCDLR            
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENGLIEVLKGDVQLDEALHRDTSTNVWILPQTEAGSTNYDLVASPAMGALLDQVRPAFDLIILDTAPVLPLAEARALASI
ENGLIEVLKGDVQLDEALHRDTSTNVWILPQTEAGSTNYDLVASPAMGALLDQVRPAFDLIILDTAPVLPLAEARALASI
                                                            IILDTAP             
       650       660       670       680       690       700      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
ADGVLLVVRWRTTPVQAAQMAIDLLGRSGARILGVAMTIVNMKQHARSGYGDEMAYYHRFKEYYSG
ADGVLLVVRWRTTPVQAAQMAIDLLGRSGARILGVAMTIVNMKQHARSGYGDEMAYYHRFKE    
                                                 YGDEMAYYHRFKEYY  

© 1998-2019