BYKdb

Annotate results for A0A031JZD3

A0A031JZD3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A031JZD3
DOMAINtad27/183DRIDPGILIAFLRRRWPIMLGMLLASLASGFALTATRTPTYLATAEITLDPKVEPIAPLT
DEDRLAAQGGMGETWIDTQVEVITSSDNVAAVVDRLALPRRFARDDRTAAQARQAAIDYV
AGGVSAFRSGATYTLSVSFESEDAQEAARIANAFAAQ
DOMAINcd527/717TSALPAEGKTTVALCLARSMAGASDAILLIDCDVRRRGVSRWIGGTREIGLLEVLRGDAR
LEDAIVIDPRTGLSILPLSAAREEDHALLTGPAMDALLAAAGQGFDAVIMDTAPVLPMAD
ARLLLGKADAAVIAARWRRTPEAAIRSLLRLLPEGAVGLAGAILTRVDVRKQAAFGLDEN
AFYKAYKDYYA
SITEWalker A534/536GKT
SITEWalker A'554/561LLIDCDVR
SITEWalker B634/640VIMDTAP
SITEY Cluster709/716YKAYKDYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQPIVLAPPPGVIVPPVRPGAAETPDRIDPGILIAFLRRRWPIMLGMLLASLASGFALTATRTPTYLATAEITLDPKVE
                          DRIDPGILIAFLRRRWPIMLGMLLASLASGFALTATRTPTYLATAEITLDPKVE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PIAPLTDEDRLAAQGGMGETWIDTQVEVITSSDNVAAVVDRLALPRRFARDDRTAAQARQAAIDYVAGGVSAFRSGATYT
PIAPLTDEDRLAAQGGMGETWIDTQVEVITSSDNVAAVVDRLALPRRFARDDRTAAQARQAAIDYVAGGVSAFRSGATYT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSVSFESEDAQEAARIANAFAAQYTEGGVTEKEAADTRALREIGARMAKASTQASADAAVLSHYRLAHDLPSTSDRSLTE
LSVSFESEDAQEAARIANAFAAQ                                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEISAYNQEVTSARAQAAEDAARLATARQQLGSGSSGEDVGESLGSPVIASLRQQQSAYAAEIASLSSKYGPRHPDLQRA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSRLASVDAQIAEEIGRVVSNLSAKAAVSQRRLGSLSGSLRASEGALRRDNVAMVDLQDLEQRAQASRQLYESYLGRYKE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAARIGIRQPQARVLHPAQPSDRPARPDILLNMVLAGAIGLGLGLACAIAAELMFSGFTTGEEIERRLGLRYLCSIPELG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVASRKARGDPVDAVVEQPRSAFAEAFRNLRASIAFAVESPRIIAVTSALPAEGKTTVALCLARSMAGASDAILLIDCDV
                                              TSALPAEGKTTVALCLARSMAGASDAILLIDCDV
                                                     GKT                 LLIDCDV
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRRGVSRWIGGTREIGLLEVLRGDARLEDAIVIDPRTGLSILPLSAAREEDHALLTGPAMDALLAAAGQGFDAVIMDTAP
RRRGVSRWIGGTREIGLLEVLRGDARLEDAIVIDPRTGLSILPLSAAREEDHALLTGPAMDALLAAAGQGFDAVIMDTAP
R                                                                        VIMDTAP
       650       660       670       680       690       700       710       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
VLPMADARLLLGKADAAVIAARWRRTPEAAIRSLLRLLPEGAVGLAGAILTRVDVRKQAAFGLDENAFYKAYKDYYA
VLPMADARLLLGKADAAVIAARWRRTPEAAIRSLLRLLPEGAVGLAGAILTRVDVRKQAAFGLDENAFYKAYKDYYA
                                                                    YKAYKDYY 

© 1998-2019