BYKdb

Annotate results for A0A031MA75

A0A031MA75 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A031MA75
DOMAINtad43/220EGIDILRLFLYVVHYRWLLATLVAVGIVCALAVTMMMTPQYRATARLEVLVPSAKVFQDI
EVTSEGSDMRSYLTAREKLKSRSLAQRVVFNLGLGEREDFLFPRPSFSPLNILNRAFGRS
PGGDISQYSADERANMAVDRVLANLSVDPITNTSLLSISYSDQQPRYAYEIANQVAQS
DOMAINcd554/747TSSEPSEGKSTTVFKLAEDFGALGAKVLVVDADLRKPVVHRIFKVDNIVGLSNVLTNTIR
RDDLPKLIKPVGGNVSVMTAGMIPPNPADLLSSSRMGLLLQKLSRSYDLVLIDSPPIIGL
SDAPILSRLTEATLLVVSSNQVTRKAARAALKRIQAAGSNVLGVAMTKFAVRKLDYNYSY
KYLSYNYYSYGDET
SITEWalker A561/563GKS
SITEWalker A'581/588LVVDADLR
SITEWalker B663/669VLIDSPP
SITEY Cluster729/743YNYSYKYLSYNYYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFDRHRQIGPEHPGSGAVAVPGAWYDPRLHIQDYAYEPPQQEEGIDILRLFLYVVHYRWLLATLVAVGIVCALAVTMMMT
                                          EGIDILRLFLYVVHYRWLLATLVAVGIVCALAVTMMMT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PQYRATARLEVLVPSAKVFQDIEVTSEGSDMRSYLTAREKLKSRSLAQRVVFNLGLGEREDFLFPRPSFSPLNILNRAFG
PQYRATARLEVLVPSAKVFQDIEVTSEGSDMRSYLTAREKLKSRSLAQRVVFNLGLGEREDFLFPRPSFSPLNILNRAFG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSPGGDISQYSADERANMAVDRVLANLSVDPITNTSLLSISYSDQQPRYAYEIANQVAQSFIDQRVDQASDTSSQARKFI
RSPGGDISQYSADERANMAVDRVLANLSVDPITNTSLLSISYSDQQPRYAYEIANQVAQS                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEQVLQVKERLQQSEEALVDYAKSAGITITGSDSSLIAANLTEINKALALAMQESLDYGRLVQQIDNGQGASLEQVLKSE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLEKLRGKLAELNAEYQQKLAFFKPGFPEMQQLRSQIREIENQLNLGIAAVTDSIRIKHTETLAKVQDLRNKLAELEAEQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAYQDKNIRYTILKREVDSNRSQYENLIAKLNEVAVGSELRNQNAAVVDMAVMPRSPYSPRLPVNLAIGLVLSMVIGAAA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VYVLELLNNTFTNPEQVEKELRLPILGILPAIDDREFGQAVADPRSGLSESYRSLRTSLQFSGEQGAPRVLLVTSSEPSE
                                                                         TSSEPSE

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKSTTVFKLAEDFGALGAKVLVVDADLRKPVVHRIFKVDNIVGLSNVLTNTIRRDDLPKLIKPVGGNVSVMTAGMIPPNP
GKSTTVFKLAEDFGALGAKVLVVDADLRKPVVHRIFKVDNIVGLSNVLTNTIRRDDLPKLIKPVGGNVSVMTAGMIPPNP
GKS                 LVVDADLR                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLLSSSRMGLLLQKLSRSYDLVLIDSPPIIGLSDAPILSRLTEATLLVVSSNQVTRKAARAALKRIQAAGSNVLGVAMT
ADLLSSSRMGLLLQKLSRSYDLVLIDSPPIIGLSDAPILSRLTEATLLVVSSNQVTRKAARAALKRIQAAGSNVLGVAMT
                      VLIDSPP                                                   
       730       740       750       760       770       780       790
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KFAVRKLDYNYSYKYLSYNYYSYGDETPKLESKGGEGGSSTHAKNWSLASVSGRVRKHLRDLGDRIKSAS
KFAVRKLDYNYSYKYLSYNYYSYGDET                                           
        YNYSYKYLSYNYYSY                                               

© 1998-2019