BYKdb

Annotate results for A0A034TR42

A0A034TR42 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A034TR42
DOMAINtad14/255DEIDLGKLFGIILDAKWLILCTVVLFSIIGVGVAILSTPIYKADALIQIESKSSGGISAM
VGDMGELFSAESSATTEIEIIKSRMILGGTVDKFNLTTVVSPNYMPIIGKGLARLQGEQI
SLSVSRFNTPPSYAVGIPLTLEVIDSEKQTFKLIEDDNNVILEGKVGELIEKNGYQFLAT
EMIAQDGASFTVSKVSKLDAINALQQNLSISERGKQTGIISLSFSGEDRAKIQAILNDIS
QN
DOMAINcd534/722SGPAPSIGKTFVSTNFAAVAAKTGQKVLLIDADMRKGYLQQCFGLRWDNGLSDYLSGKTS
HSNIIKSTSIDNLDVVTRGQVPPNPSELLMHPRFKSFVDEMSAQYDLVIIDTPPVLAVTD
PSIVGAIAGTTLMVARFDQTTLKEIEVAQGRFEQSGVEVKGVILNAVEKKASNSYGYGYG
YYNYAYKSE
SITE-590/-592GKT
SITEWalker A'561/568LLIDADMR
SITEWalker B641/647VIIDTPP
SITEY Cluster708/719YGYGYGYYNYAY
SITEWalker A541/543GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTTQTIKQSRQADDEIDLGKLFGIILDAKWLILCTVVLFSIIGVGVAILSTPIYKADALIQIESKSSGGISAMVGDMGEL
             DEIDLGKLFGIILDAKWLILCTVVLFSIIGVGVAILSTPIYKADALIQIESKSSGGISAMVGDMGEL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FSAESSATTEIEIIKSRMILGGTVDKFNLTTVVSPNYMPIIGKGLARLQGEQISLSVSRFNTPPSYAVGIPLTLEVIDSE
FSAESSATTEIEIIKSRMILGGTVDKFNLTTVVSPNYMPIIGKGLARLQGEQISLSVSRFNTPPSYAVGIPLTLEVIDSE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQTFKLIEDDNNVILEGKVGELIEKNGYQFLATEMIAQDGASFTVSKVSKLDAINALQQNLSISERGKQTGIISLSFSGE
KQTFKLIEDDNNVILEGKVGELIEKNGYQFLATEMIAQDGASFTVSKVSKLDAINALQQNLSISERGKQTGIISLSFSGE

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRAKIQAILNDISQNYFLQNVQRNSAEAEQSLEFLKGHLPDIKTKLTASEDVLNRFRQENESIDLGLEAQSTLKVMVELE
DRAKIQAILNDISQN                                                                 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQLNELTFKESEISQRFTQDHPAYKSLLDKRETLLKEKERLNKQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIKAGTVGNVRILDNAQSFSKPIKPKKALIVVLATLLGGMAGVAFVLIRAAFHRGVETPDQIEQIGMPVYASVPKSIQQL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFANKLKRNKGSNDELVLLAEANPADLSIEALRSLRTSLHFAMMEAKNNVLMISGPAPSIGKTFVSTNFAAVAAKTGQKV
                                                     SGPAPSIGKTFVSTNFAAVAAKTGQKV
                                                            GKT                 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIDADMRKGYLQQCFGLRWDNGLSDYLSGKTSHSNIIKSTSIDNLDVVTRGQVPPNPSELLMHPRFKSFVDEMSAQYDL
LLIDADMRKGYLQQCFGLRWDNGLSDYLSGKTSHSNIIKSTSIDNLDVVTRGQVPPNPSELLMHPRFKSFVDEMSAQYDL
LLIDADMR                                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIIDTPPVLAVTDPSIVGAIAGTTLMVARFDQTTLKEIEVAQGRFEQSGVEVKGVILNAVEKKASNSYGYGYGYYNYAYK
VIIDTPPVLAVTDPSIVGAIAGTTLMVARFDQTTLKEIEVAQGRFEQSGVEVKGVILNAVEKKASNSYGYGYGYYNYAYK
VIIDTPP                                                            YGYGYGYYNYAY 
  
..
SE
SE

© 1998-2019