BYKdb

Annotate results for A0A037UQM4

A0A037UQM4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A037UQM4
DOMAINtad49/220LAVSFRRYAHLLGKHKWVIMGMILMSCVLGAIHTLLKTPLYAANVRIQIEREGAKIVESG
TTSPTETGSADFLRTQYELLKSRAMAERVTSALYLYKDDSFFKPRDVSTLGLITGYFSRP
TSSQASKVATAADILMNAVTIKPVPGSRLVDIRYLDPNPQRAQIIANGYADA
DOMAINcd555/744TSAGAGEGKSTTAVAIARHFAQMGLKVLLIDADLRRPSLHIKLNLDNSIGLSNYLTGSSM
PPDLVQRTDHPNLAFMASGPLPPNAADLLSGPRIYSLISLGSDVFNLIVFDSPPVLGLAD
AQLLSSASAATVFVVGAGDNRKGALRAALRRMSMARVTLLGTLLTKLDSKSVGYAYGQGY
DYKYGYHMND
SITEWalker A562/564GKS
SITEWalker A'582/589LLIDADLR
SITEWalker B662/668IVFDSPP
SITEY Cluster728/740YAYGQGYDYKYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQDTFRGGADDHPRGSQALVRAEAYAVAPARLGYASVGYGAAPEEEEKLAVSFRRYAHLLGKHKWVIMGMILMSCVLGAI
                                                LAVSFRRYAHLLGKHKWVIMGMILMSCVLGAI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HTLLKTPLYAANVRIQIEREGAKIVESGTTSPTETGSADFLRTQYELLKSRAMAERVTSALYLYKDDSFFKPRDVSTLGL
HTLLKTPLYAANVRIQIEREGAKIVESGTTSPTETGSADFLRTQYELLKSRAMAERVTSALYLYKDDSFFKPRDVSTLGL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ITGYFSRPTSSQASKVATAADILMNAVTIKPVPGSRLVDIRYLDPNPQRAQIIANGYADAYIASNLNRRFEANAYAKTFL
ITGYFSRPTSSQASKVATAADILMNAVTIKPVPGSRLVDIRYLDPNPQRAQIIANGYADA                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDQIKQLQIRLQESEQALIDFAEKEGMVEVNDKASIAENSLAAANTAAGQLISERIKNEQLWRQVESTNAINLPQLLTNQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVDTLRGQRKALETEYQEKLENFKPSYPEMVQISNKIKEVYRQLAAEVKAIRNSLKAAYQSSLAQEVEMKGRIEELRAEV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDLQKKGIRHNILKREVETNRNLYNSLLQRLKEVDVAGGVGANNIFIVDRAVAPNFPSEPSLSRALFLAFGFGLIIGIGF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLLLEMLDDRVRASEEVEEISGLPTLGIIPRDESEMELNLVLKDPRSHVAEAYRSFATALQFSTDTGLPRSIAVTSAGAG
                                                                          TSAGAG

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGKSTTAVAIARHFAQMGLKVLLIDADLRRPSLHIKLNLDNSIGLSNYLTGSSMPPDLVQRTDHPNLAFMASGPLPPNAA
EGKSTTAVAIARHFAQMGLKVLLIDADLRRPSLHIKLNLDNSIGLSNYLTGSSMPPDLVQRTDHPNLAFMASGPLPPNAA
 GKS                 LLIDADLR                                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLLSGPRIYSLISLGSDVFNLIVFDSPPVLGLADAQLLSSASAATVFVVGAGDNRKGALRAALRRMSMARVTLLGTLLTK
DLLSGPRIYSLISLGSDVFNLIVFDSPPVLGLADAQLLSSASAATVFVVGAGDNRKGALRAALRRMSMARVTLLGTLLTK
                     IVFDSPP                                                    
       730       740       750         
....:....|....:....|....:....|....:....
LDSKSVGYAYGQGYDYKYGYHMNDDEADGSTQTPQLARY
LDSKSVGYAYGQGYDYKYGYHMND               
       YAYGQGYDYKYGY                   

© 1998-2019