BYKdb

Annotate results for A0A037ZBB8

A0A037ZBB8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A037ZBB8
DOMAINcd42/230TSSGPGEGKSTTSSNLAVVMAQGGSKTIIIDCDQRKPRLHKLFSLSNESGLSDLLAGNTE
FSQAVHKTEIENLDILPAGTRPPNPSELLSSKKMGSFIEELRGEYDCIILDTPPVIAVTD
AQLLASKADGCVLVLSSGEVEREAAMKAKELLEKVQAKIIGVVLNKLEVSEKGYYGYYYH
YYYGNDGEK
SITEWalker A49/51GKS
SITEWalker A'69/76IIIDCDQR
SITEWalker B149/155IILDTPP
SITEY Cluster215/224YYGYYYHYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGKVDLISVKDPKSPISEAYRTLRTNIQFSSFDKKIQTIVITSSGPGEGKSTTSSNLAVVMAQGGSKTIIIDCDQRKPRL
                                         TSSGPGEGKSTTSSNLAVVMAQGGSKTIIIDCDQRKPRL
                                                GKS                 IIIDCDQR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKLFSLSNESGLSDLLAGNTEFSQAVHKTEIENLDILPAGTRPPNPSELLSSKKMGSFIEELRGEYDCIILDTPPVIAVT
HKLFSLSNESGLSDLLAGNTEFSQAVHKTEIENLDILPAGTRPPNPSELLSSKKMGSFIEELRGEYDCIILDTPPVIAVT
                                                                    IILDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAQLLASKADGCVLVLSSGEVEREAAMKAKELLEKVQAKIIGVVLNKLEVSEKGYYGYYYHYYYGNDGEKIKKKKSKNSK
DAQLLASKADGCVLVLSSGEVEREAAMKAKELLEKVQAKIIGVVLNKLEVSEKGYYGYYYHYYYGNDGEK          
                                                      YYGYYYHYYY                
     
....:
EDLAV


© 1998-2019