BYKdb

Annotate results for A0A059DZ48

A0A059DZ48 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A059DZ48
DOMAINtad40/230MPTDLKSLLAAVYRRFWLIALSFLAVFSLVAYMTFNQVPLYKASSIVQLDTEQQNVIDLG
SVLSGLAVSTAVIDTEVMIMKSKSLLTKVAVKQKLVEDPEFNWTLREPETSVLGSLSDSF
LGFLGVDTTEEDPFEGMSVDERENALLESAVAKLMGSVGVSRVGTTYLINVEVTSESPET
AARLANAIADQ
DOMAINcd577/767TSSLPDEGKTSLTLALGRMSAMSGARTLVIDGDFRRRQLTEAAGLKPEVGFIEYLFGAGQ
LSDAIAKDPKSMLDILPLSLTGHTPHDVFGTRAFDDLLVRLRSMYDLILIDTGPLLLMAE
ARVVAGKTDKTILVVRWRHTTRAAARQSLALLKSFQADLLGVTLNMVNLNRRRHYSDPGA
SYDAYRKYYQM
SITE-702/-704GKT
SITEWalker A'604/611LVIDGDFR
SITEWalker B684/690ILIDTGP
SITEY Cluster758/765YDAYRKYY
SITEWalker A584/586GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGRSKFSVNSNFRYSILTKTFSFELPTQVPAEADSDGNTMPTDLKSLLAAVYRRFWLIALSFLAVFSLVAYMTFNQVPLY
                                       MPTDLKSLLAAVYRRFWLIALSFLAVFSLVAYMTFNQVPLY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KASSIVQLDTEQQNVIDLGSVLSGLAVSTAVIDTEVMIMKSKSLLTKVAVKQKLVEDPEFNWTLREPETSVLGSLSDSFL
KASSIVQLDTEQQNVIDLGSVLSGLAVSTAVIDTEVMIMKSKSLLTKVAVKQKLVEDPEFNWTLREPETSVLGSLSDSFL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GFLGVDTTEEDPFEGMSVDERENALLESAVAKLMGSVGVSRVGTTYLINVEVTSESPETAARLANAIADQYRVQQLETKL
GFLGVDTTEEDPFEGMSVDERENALLESAVAKLMGSVGVSRVGTTYLINVEVTSESPETAARLANAIADQ          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DATRRATEWLSDRVFALREEVEEKENRVAKFIADNDMETAMGNTLTEQNIAYLTTQKTQAEVELNRVRSRYDSMRRQIDG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAGVDGISEVLESPLITSLKQQLSTVRGRVGDLETRLGPQHPELIGARAEQADIERQIENEMNRIATNLENEVRVRRDQV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRLQSQINNSNAKLRGNSLAMVRLRELERDAETSRVLYEEFISRSKETREQDGLVQPDAVILSQASVPKHPSSPRTKLNL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIGAILGGMLGAGLALLAELLDMKISSTEDIEKKLRQNAIGSVPLIRTTNALGFTQTNPAEYLIENPLSAFAESVRYLRA


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIAFSDLDSETKTVAITSSLPDEGKTSLTLALGRMSAMSGARTLVIDGDFRRRQLTEAAGLKPEVGFIEYLFGAGQLSDA
                TSSLPDEGKTSLTLALGRMSAMSGARTLVIDGDFRRRQLTEAAGLKPEVGFIEYLFGAGQLSDA
                       GKT                 LVIDGDFR                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAKDPKSMLDILPLSLTGHTPHDVFGTRAFDDLLVRLRSMYDLILIDTGPLLLMAEARVVAGKTDKTILVVRWRHTTRAA
IAKDPKSMLDILPLSLTGHTPHDVFGTRAFDDLLVRLRSMYDLILIDTGPLLLMAEARVVAGKTDKTILVVRWRHTTRAA
                                           ILIDTGP                              
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARQSLALLKSFQADLLGVTLNMVNLNRRRHYSDPGASYDAYRKYYQMESKPSLFSFMRGGSKKSKSGKIQPTAIQTPPSL
ARQSLALLKSFQADLLGVTLNMVNLNRRRHYSDPGASYDAYRKYYQM                                 
                                     YDAYRKYY                                   
       810    
....:....|....
ADHKTGAAEKVDAN


© 1998-2019