BYKdb

Annotate results for A0A059FYR6

A0A059FYR6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A059FYR6
DOMAINtad25/216SAFDLKSLITMVYRRFWLIFTGFITVLSLVVFITFTQTPTYRSQAIIQLDTNQINVIDLG
ALFSGAGGATTSVIDTEVRVIASKTLLSRVAEEQNLIEDPEFNWTLRPKKETFISSSQKA
VVGLMGGDTSEKDPFAGMTPEQKEAEIFEAVVGTLMSKVAVGRVGATYLLTVDVTSTSPA
TAARLANEVAEQ
DOMAINcd563/753TSSLPDEGKTSLALSLGRMSAMSGSRTLVIDGDFRRRQLTEMAGMKPEIGLVEHLFGAGQ
LSDAIAKDHKTMLDVLPLSLNGHTPHDVFGTRAFDELLSRLRAMYDLILIDTGPLLLMAE
ARVVAGKVDKAILVVRWRQTTRSAARQSLTLLRNFKADVLGVTLNMVDLNRRRHHRDPGA
TYKAYRKYYQM
SITEWalker A570/572GKT
SITEWalker A'590/597LVIDGDFR
SITEWalker B670/676ILIDTGP
SITEY Cluster744/751YKAYRKYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKSYTVEIPSNADIGGSSGGIDTSAFDLKSLITMVYRRFWLIFTGFITVLSLVVFITFTQTPTYRSQAIIQLDTNQINV
                        SAFDLKSLITMVYRRFWLIFTGFITVLSLVVFITFTQTPTYRSQAIIQLDTNQINV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDLGALFSGAGGATTSVIDTEVRVIASKTLLSRVAEEQNLIEDPEFNWTLRPKKETFISSSQKAVVGLMGGDTSEKDPFA
IDLGALFSGAGGATTSVIDTEVRVIASKTLLSRVAEEQNLIEDPEFNWTLRPKKETFISSSQKAVVGLMGGDTSEKDPFA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GMTPEQKEAEIFEAVVGTLMSKVAVGRVGATYLLTVDVTSTSPATAARLANEVAEQYRVQQLEKKYDATRKATEWLQERV
GMTPEQKEAEIFEAVVGTLMSKVAVGRVGATYLLTVDVTSTSPATAARLANEVAEQ                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGLREEVEEKEQAVETFRAETGLLEAQGTTLTEQQIAYLTSQRGQAQIEVDRARARYNSMRRQIDSGAGVEGVSEVINSP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LINDLKTQRSELLRRVAELETRVGDRHPDLISARNEVADIDRQMNSEMNRIAANLESELNVARAQLGSIQGEIGRSTSQL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RGNNVNLVRLRELERDAQTSRVMLEEFLARSKQTREQDALITADSSILSTASVPFRPASPRKAFNLIIGCVLGLVVGVFL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIVAELFDSNISSSEDVENKLGSNPIGSVPLIRTAGLLGLGQTSPADFLVENPLSAYAESIRYLRAAIAFSDLDSETKTV


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AITSSLPDEGKTSLALSLGRMSAMSGSRTLVIDGDFRRRQLTEMAGMKPEIGLVEHLFGAGQLSDAIAKDHKTMLDVLPL
  TSSLPDEGKTSLALSLGRMSAMSGSRTLVIDGDFRRRQLTEMAGMKPEIGLVEHLFGAGQLSDAIAKDHKTMLDVLPL
         GKT                 LVIDGDFR                                           
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLNGHTPHDVFGTRAFDELLSRLRAMYDLILIDTGPLLLMAEARVVAGKVDKAILVVRWRQTTRSAARQSLTLLRNFKAD
SLNGHTPHDVFGTRAFDELLSRLRAMYDLILIDTGPLLLMAEARVVAGKVDKAILVVRWRQTTRSAARQSLTLLRNFKAD
                             ILIDTGP                                            
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLGVTLNMVDLNRRRHHRDPGATYKAYRKYYQMEAKPGIFGWTKPKKPKPNKQGPKSSIATQVPPSKASGRPETIERISA
VLGVTLNMVDLNRRRHHRDPGATYKAYRKYYQM                                               
                       YKAYRKYY                                                 
 
.
E


© 1998-2019