BYKdb

Annotate results for A0A059G5G5

A0A059G5G5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A059G5G5
DOMAINtad1/191MPIDFKALIGTVYRRFWIIVTGFLVTLFAVAYITFTQTPIYKANSILQLDTNKENVIDLG
SVLGGLAASTATIDTEVRVMGSKSLLTKVATKLKLAEDPEFNWTLREQKPGLIEMTKGQI
GAWTGHPPKKTVPYANLSAAEREAAILESVTRTLMSKVHISRIGTTYLIEVEVTSQSPET
AARVADAVADQ
DOMAINcd538/728TSSLPDEGKTSLTLSLGRMSAMSGSRTLVIDGDFRRRQLTDAAGMSPEIGFIEHLFGAGQ
LSDAICKDSRSMLDILPLSKAGHVPHDVFGTRAFDDLLARLRSMYDLILIDTGPLLLMAE
ARVVAGKTDKTILVIRWRRSLRSAVRQSLTLLKTFNADLLGVTLNMVDLTQRRHHKDPGA
AYKAYSKYYSM
SITE-663/-665GKT
SITEWalker A'565/572LVIDGDFR
SITEWalker B645/651ILIDTGP
SITEY Cluster719/726YKAYSKYY
SITEWalker A545/547GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPIDFKALIGTVYRRFWIIVTGFLVTLFAVAYITFTQTPIYKANSILQLDTNKENVIDLGSVLGGLAASTATIDTEVRVM
MPIDFKALIGTVYRRFWIIVTGFLVTLFAVAYITFTQTPIYKANSILQLDTNKENVIDLGSVLGGLAASTATIDTEVRVM

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSKSLLTKVATKLKLAEDPEFNWTLREQKPGLIEMTKGQIGAWTGHPPKKTVPYANLSAAEREAAILESVTRTLMSKVHI
GSKSLLTKVATKLKLAEDPEFNWTLREQKPGLIEMTKGQIGAWTGHPPKKTVPYANLSAAEREAAILESVTRTLMSKVHI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRIGTTYLIEVEVTSQSPETAARVADAVADQYRVQQLDSKLEATRRATAWLSERVAGLRDEVEAKEKRVEEFRAETGLLS
SRIGTTYLIEVEVTSQSPETAARVADAVADQ                                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQGATLTEQQIAYNTTQKSQLQAQLNRARSRYDNMRRQINSGAGIDAIAEVLDSPVISGLKAQRAQILRRVAELETTLGP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SHPELIGARNEAADIEKQIEAEVSRIAANLENEVKAAQDQINSINSNIGQSTAQLRGNNLNLVRLRELERDAETSRVLYE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFISRSKETREQDDLVQADANILSTATVPDSPSSPKKLLNLIIGAMLGGIIGGGLALLAEIFDMKISSPDDIERKLGVNS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IGSVPLIRSTSLLPFSQTNPADFLVDNPLSAFAESIRYLRAAIAFSDLDSETKTVAITSSLPDEGKTSLTLSLGRMSAMS
                                                         TSSLPDEGKTSLTLSLGRMSAMS
                                                                GKT             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSRTLVIDGDFRRRQLTDAAGMSPEIGFIEHLFGAGQLSDAICKDSRSMLDILPLSKAGHVPHDVFGTRAFDDLLARLRS
GSRTLVIDGDFRRRQLTDAAGMSPEIGFIEHLFGAGQLSDAICKDSRSMLDILPLSKAGHVPHDVFGTRAFDDLLARLRS
    LVIDGDFR                                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MYDLILIDTGPLLLMAEARVVAGKTDKTILVIRWRRSLRSAVRQSLTLLKTFNADLLGVTLNMVDLTQRRHHKDPGAAYK
MYDLILIDTGPLLLMAEARVVAGKTDKTILVIRWRRSLRSAVRQSLTLLKTFNADLLGVTLNMVDLTQRRHHKDPGAAYK
    ILIDTGP                                                                   YK
       730       740       750       760       770     
....:....|....:....|....:....|....:....|....:....|....:
AYSKYYSMETKRSIFGRNKPAKSNGMTSAPNPMAAPLKPEKPQVKTGSSSEVSTH
AYSKYYSM                                               
AYSKYY                                                 

© 1998-2019