BYKdb

Annotate results for A0A059IPK4

A0A059IPK4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A059IPK4
DOMAINcd101/283TSPNKACGKTTVSLNLALAMARQADLRVMLLDFDLRRPSLARLLGQQAGSHDLAALLAGT
RDFSEHAVRFGPNLAIGLNRRPVPHSAETLLGSSTASTLDDIESRFKPDVIIFDTAPMMG
NDDNLAFLGQVDCALLVAAADSTSARQVDSSERDLSGLTNVLGTVMNKCRYLDEHDGYGG
EYY
SITEWalker A108/110GKT
SITEWalker A'129/136MLLDFDLR
SITEWalker B211/217IIFDTAP
SITEY Cluster278/283YGGEYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MERLEAAMAKARAARKATKDGEAPDHRPRQAPQPDSGRPIKDVRPEALWTALHEIPIGNALARKMRLSALMGSEFAAPYD


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILRTRVLRQMRAEGWKRLAVTSPNKACGKTTVSLNLALAMARQADLRVMLLDFDLRRPSLARLLGQQAGSHDLAALLAGT
                    TSPNKACGKTTVSLNLALAMARQADLRVMLLDFDLRRPSLARLLGQQAGSHDLAALLAGT
                           GKT                  MLLDFDLR                        
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDFSEHAVRFGPNLAIGLNRRPVPHSAETLLGSSTASTLDDIESRFKPDVIIFDTAPMMGNDDNLAFLGQVDCALLVAAA
RDFSEHAVRFGPNLAIGLNRRPVPHSAETLLGSSTASTLDDIESRFKPDVIIFDTAPMMGNDDNLAFLGQVDCALLVAAA
                                                  IIFDTAP                       
       250       260       270       280   
....:....|....:....|....:....|....:....|...
DSTSARQVDSSERDLSGLTNVLGTVMNKCRYLDEHDGYGGEYY
DSTSARQVDSSERDLSGLTNVLGTVMNKCRYLDEHDGYGGEYY
                                     YGGEYY
© 1998-2019