BYKdb

Annotate results for A0A060LYA2

A0A060LYA2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A060LYA2
DOMAINcd54/231TSAGPGEGKSTTASNLAVVMGQNGQRVLLIDADMRKPTAHYTFSLMNTHGLTNVLTRQQK
LVDVAQETSIENVSLLTCGPVPPNPAELLNSKMMEMVIKEACENFDMVIIDTPPVMAVAD
AQILSSKVDGTIIVTSSGKTDRDQLEQTKANLVKAKANILGVVLNNKPIDQNTYYYYQ
SITE-191/-193GKT
SITEWalker A'81/88LLIDADMR
SITEWalker B161/167VIIDTPP
SITEY Cluster227/230YYYY
SITEWalker A61/63GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVRSTRTKKGQGQKKRQLIADVNKHSPITEQYRNIRTNIEYSAIDTDIHSLLITSAGPGEGKSTTASNLAVVMGQNGQRV
                                                     TSAGPGEGKSTTASNLAVVMGQNGQRV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIDADMRKPTAHYTFSLMNTHGLTNVLTRQQKLVDVAQETSIENVSLLTCGPVPPNPAELLNSKMMEMVIKEACENFDM
LLIDADMRKPTAHYTFSLMNTHGLTNVLTRQQKLVDVAQETSIENVSLLTCGPVPPNPAELLNSKMMEMVIKEACENFDM
LLIDADMR                                                                        
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
VIIDTPPVMAVADAQILSSKVDGTIIVTSSGKTDRDQLEQTKANLVKAKANILGVVLNNKPIDQNTYYYYQ
VIIDTPPVMAVADAQILSSKVDGTIIVTSSGKTDRDQLEQTKANLVKAKANILGVVLNNKPIDQNTYYYYQ
VIIDTPP                                                           YYYY 
© 1998-2019