BYKdb

Annotate results for A0A060RD97

A0A060RD97 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A060RD97
DOMAINtad12/256PKSLTARQVVELVLANWYWFAVSLLVALLLGGYLYVKSPLVFKRQASIMLKDKSGSGQGE
AAIFADLGLLSSTSSLVDNEIFILRSASLMRTVVQKLDLNVSYSYMGRFRKLDIYGEETP
IVVKNVAESEQSNNPVSFTVTPKNSEAFQLSYIDENETRVSIEKKFGDTVLIRNVLIEIK
PTISAEKFVGKEVNVAVTSVAKAQLDFSSRLTVARADKVSSVVNLSFIDQSPQRATAVLN
TLIAE
DOMAINcd591/783TSTVKGEGKTFVSTNLALSLSFINKRVLLIDMDLRKATLSKNLSLGGRAGVTNYLLGKVD
KLSDVVLSGVLGSGVDFIPGGAKVASVPSLLTSPEFDKFIDDLRPMYDYILLDNPPAPLI
VDTQIINRVVDFTLYVMRSGKIDRRYLPEMERQYQEKRFNNLNILITDSKMRSKIYGYGS
YGYGYSYGYGYGA
SITEWalker A598/600GKT
SITEWalker A'618/625LLIDMDLR
SITEWalker B700/706ILLDNPP
SITE-697/-699YDY
SITEY Cluster766/781YGYGSYGYGYSYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVENKINNEQDPKSLTARQVVELVLANWYWFAVSLLVALLLGGYLYVKSPLVFKRQASIMLKDKSGSGQGEAAIFADLGL
           PKSLTARQVVELVLANWYWFAVSLLVALLLGGYLYVKSPLVFKRQASIMLKDKSGSGQGEAAIFADLGL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSSTSSLVDNEIFILRSASLMRTVVQKLDLNVSYSYMGRFRKLDIYGEETPIVVKNVAESEQSNNPVSFTVTPKNSEAFQ
LSSTSSLVDNEIFILRSASLMRTVVQKLDLNVSYSYMGRFRKLDIYGEETPIVVKNVAESEQSNNPVSFTVTPKNSEAFQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSYIDENETRVSIEKKFGDTVLIRNVLIEIKPTISAEKFVGKEVNVAVTSVAKAQLDFSSRLTVARADKVSSVVNLSFID
LSYIDENETRVSIEKKFGDTVLIRNVLIEIKPTISAEKFVGKEVNVAVTSVAKAQLDFSSRLTVARADKVSSVVNLSFID

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSPQRATAVLNTLIAEYNTESIMDKNRIARNTDIFIMERLAKLSKDLEGVDTDIADYKQQSNVLDFSAAANMYMQTSNEI
QSPQRATAVLNTLIAE                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRDAAEVENQIAMANYIKDYLLDPINANALIPRVSGAQNLGVDSQIDSYNELRLKLDKMLESSGENNPLVVDGRTQLSAL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KMTIIQAINNTVNSLKIKQQNIRNEENLSNRRIASVPTKEKDVAGIVRQQKIKEELYLYLLNKREENALNLAITIPEARV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDAADGPPNPIAPRLILFAAVSIIGGFALPFAVIFLIIMLDVKVRGRKDVEAYTTIPVLNELPRKSKKQKDDVVVKRGGH


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVMSEAFQILRGNIDFSFKRTKPGAMVIASTSTVKGEGKTFVSTNLALSLSFINKRVLLIDMDLRKATLSKNLSLGGRAG
                              TSTVKGEGKTFVSTNLALSLSFINKRVLLIDMDLRKATLSKNLSLGGRAG
                                     GKT                 LLIDMDLR               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTNYLLGKVDKLSDVVLSGVLGSGVDFIPGGAKVASVPSLLTSPEFDKFIDDLRPMYDYILLDNPPAPLIVDTQIINRVV
VTNYLLGKVDKLSDVVLSGVLGSGVDFIPGGAKVASVPSLLTSPEFDKFIDDLRPMYDYILLDNPPAPLIVDTQIINRVV
                                                           ILLDNPP              
       730       740       750       760       770       780       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
DFTLYVMRSGKIDRRYLPEMERQYQEKRFNNLNILITDSKMRSKIYGYGSYGYGYSYGYGYGAKMEE
DFTLYVMRSGKIDRRYLPEMERQYQEKRFNNLNILITDSKMRSKIYGYGSYGYGYSYGYGYGA    
                                             YGYGSYGYGYSYGYGY      

© 1998-2019