BYKdb

Annotate results for A0A061A9I9

A0A061A9I9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A061A9I9
DOMAINcd54/242TSSLAGAGKTTFVSNLAYLIAKKGKKVVIVDLDLRKPKINRVFKAANENGLTDYLAGRIN
YDKLIGYSEKLGINYIVAGERTTAVVNVLEAQKLKDLIARLKTEFDYVLLDSPPVIAVSD
ALYISRLADGVLFVVAQNEAKRAVINEALKTLRQSNVNVIGSVFTQVDLKENDIYSYTYG
YGYGYTSSD
SITEWalker A61/63GKT
SITEWalker A'81/88VIVDLDLR
SITEWalker B161/167VLLDSPP
SITE-114/-120YDKLIGY
SITEY Cluster228/238YSYTYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRRRKLFQKERTAQYDYIVSHEQPLSFVAEAFQKALVNLEYVNIDGNLKVIQFTSSLAGAGKTTFVSNLAYLIAKKGKKV
                                                     TSSLAGAGKTTFVSNLAYLIAKKGKKV
                                                            GKT                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIVDLDLRKPKINRVFKAANENGLTDYLAGRINYDKLIGYSEKLGINYIVAGERTTAVVNVLEAQKLKDLIARLKTEFDY
VIVDLDLRKPKINRVFKAANENGLTDYLAGRINYDKLIGYSEKLGINYIVAGERTTAVVNVLEAQKLKDLIARLKTEFDY
VIVDLDLR                                                                        
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLDSPPVIAVSDALYISRLADGVLFVVAQNEAKRAVINEALKTLRQSNVNVIGSVFTQVDLKENDIYSYTYGYGYGYTS
VLLDSPPVIAVSDALYISRLADGVLFVVAQNEAKRAVINEALKTLRQSNVNVIGSVFTQVDLKENDIYSYTYGYGYGYTS
VLLDSPP                                                            YSYTYGYGYGY  
       250
....:....|
SDKEAFEEKE
SD        

© 1998-2019