BYKdb

Annotate results for A0A061CBF2

A0A061CBF2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A061CBF2
DOMAINcd57/248TSAMASAGKSTVSANVSITMAQAGKKTILIDADLRRPTLHSTFNVSNSNGLTTLLTSRSK
EMDANSVIRKSGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLKQEYDMVVLDLAPILD
AAETQQLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDGGYGY
GYGYGYGYGYGE
SITEWalker A64/66GKS
SITEWalker A'84/91ILIDADLR
SITEWalker B167/173VVLDLAP
SITEY Cluster234/246YGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALFGRKNHLDNETIKNGAKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIAFTSAMASAGKSTVSANVSITMAQAG
                                                        TSAMASAGKSTVSANVSITMAQAG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKTILIDADLRRPTLHSTFNVSNSNGLTTLLTSRSKEMDANSVIRKSGVENLSILTAGPIPPNPSELLSSKHMLDLIEDL
KKTILIDADLRRPTLHSTFNVSNSNGLTTLLTSRSKEMDANSVIRKSGVENLSILTAGPIPPNPSELLSSKHMLDLIEDL
   ILIDADLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQEYDMVVLDLAPILDAAETQQLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDGGYGYGYGY
KQEYDMVVLDLAPILDAAETQQLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDGGYGYGYGY
      VVLDLAP                                                            YGYGYGY
       250       260
....:....|....:....|
GYGYGYGEEKEKKGLFGRKK
GYGYGYGE            
GYGYGY              
© 1998-2019