BYKdb

Annotate results for A0A061CJK3

A0A061CJK3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A061CJK3
DOMAINcd56/248TSAMANAGKSTVSANVAITMAQAGKKTILIDADLRRPTMHATFNVSNSNGLTTLLTSRSM
EMDANRVIRKSGVENLSILTAGPIPPNPSELLSSKHMLDLIVEDLKQEYDMVVLDLAPIL
EAGETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYG
YGYGYGYGYGEEK
SITEWalker A63/65GKS
SITEWalker A'83/90ILIDADLR
SITEWalker B167/173VVLDLAP
SITEY Cluster234/244YGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAFGRKKHLNNDTMKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIVFTSAMANAGKSTVSANVAITMAQAGK
                                                       TSAMANAGKSTVSANVAITMAQAGK
                                                              GKS               
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTILIDADLRRPTMHATFNVSNSNGLTTLLTSRSMEMDANRVIRKSGVENLSILTAGPIPPNPSELLSSKHMLDLIVEDL
KTILIDADLRRPTMHATFNVSNSNGLTTLLTSRSMEMDANRVIRKSGVENLSILTAGPIPPNPSELLSSKHMLDLIVEDL
  ILIDADLR                                                                      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQEYDMVVLDLAPILEAGETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGY
KQEYDMVVLDLAPILEAGETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGY
      VVLDLAP                                                            YGYGYGY
       250        
....:....|....:...
GYGYGEEKEKKGLFGRKK
GYGYGEEK          
GYGY              
© 1998-2019